Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3809401..3810236 | Replicon | chromosome |
| Accession | NZ_CP117049 | ||
| Organism | Escherichia coli strain MLI106K2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NL423_RS19685 | Protein ID | WP_174490806.1 |
| Coordinates | 3809401..3809778 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL423_RS19690 | Protein ID | WP_001295723.1 |
| Coordinates | 3809868..3810236 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL423_RS19660 (3804779) | 3804779..3805987 | - | 1209 | WP_000772656.1 | tyrosine-type recombinase/integrase | - |
| NL423_RS19665 (3806362) | 3806362..3807681 | + | 1320 | WP_020233731.1 | site-specific integrase | - |
| NL423_RS19670 (3807774) | 3807774..3808622 | - | 849 | WP_042047262.1 | DUF4942 domain-containing protein | - |
| NL423_RS19675 (3808707) | 3808707..3808904 | - | 198 | WP_000839267.1 | DUF957 domain-containing protein | - |
| NL423_RS19680 (3808916) | 3808916..3809404 | - | 489 | WP_042047259.1 | DUF5983 family protein | - |
| NL423_RS19685 (3809401) | 3809401..3809778 | - | 378 | WP_174490806.1 | TA system toxin CbtA family protein | Toxin |
| NL423_RS19690 (3809868) | 3809868..3810236 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL423_RS19695 (3810399) | 3810399..3810620 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| NL423_RS19700 (3810683) | 3810683..3811159 | - | 477 | WP_001186774.1 | RadC family protein | - |
| NL423_RS19705 (3811175) | 3811175..3811660 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| NL423_RS19710 (3811715) | 3811715..3812533 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NL423_RS19715 (3812633) | 3812633..3812866 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NL423_RS19720 (3812945) | 3812945..3813400 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14310.35 Da Isoelectric Point: 7.7294
>T269934 WP_174490806.1 NZ_CP117049:c3809778-3809401 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQRKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQRKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269934 WP_001295723.1 NZ_CP117049:c3810236-3809868 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|