Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 152008..152651 Replicon plasmid p174_MLI106-2
Accession NZ_CP117046
Organism Escherichia coli strain MLI106K2

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag NL423_RS00950 Protein ID WP_001034044.1
Coordinates 152235..152651 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag NL423_RS00945 Protein ID WP_001261286.1
Coordinates 152008..152238 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL423_RS00925 (148639) 148639..149394 - 756 WP_000852146.1 replication initiation protein RepE -
NL423_RS00930 (150116) 150116..150922 - 807 WP_000016970.1 site-specific integrase -
NL423_RS00935 (150923) 150923..151228 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NL423_RS00940 (151230) 151230..151448 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NL423_RS00945 (152008) 152008..152238 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NL423_RS00950 (152235) 152235..152651 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
NL423_RS00955 (152726) 152726..154291 + 1566 WP_001128474.1 AAA family ATPase -
NL423_RS00960 (154276) 154276..155298 + 1023 WP_000361402.1 helicase UvrD -
NL423_RS00965 (155552) 155552..156238 - 687 Protein_192 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..174497 174497
- flank IS/Tn - - 155552..155899 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T269919 WP_001034044.1 NZ_CP117046:152235-152651 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT269919 WP_001261286.1 NZ_CP117046:152008-152238 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References