Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1414231..1414790 | Replicon | chromosome |
| Accession | NZ_CP117039 | ||
| Organism | Vibrio parahaemolyticus strain VP220218 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PPW95_RS15325 | Protein ID | WP_031856368.1 |
| Coordinates | 1414231..1414509 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U2ZGZ5 |
| Locus tag | PPW95_RS15330 | Protein ID | WP_005497249.1 |
| Coordinates | 1414506..1414790 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPW95_RS15275 (PPW95_15275) | 1409310..1409399 | + | 90 | WP_077281740.1 | DUF3265 domain-containing protein | - |
| PPW95_RS15280 (PPW95_15280) | 1409435..1410043 | + | 609 | WP_025796196.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| PPW95_RS15285 (PPW95_15285) | 1410674..1410763 | + | 90 | WP_079878894.1 | DUF3265 domain-containing protein | - |
| PPW95_RS15290 (PPW95_15290) | 1410790..1411221 | + | 432 | WP_031856582.1 | DUF2513 domain-containing protein | - |
| PPW95_RS15295 (PPW95_15295) | 1411208..1411339 | + | 132 | WP_079882753.1 | DUF3265 domain-containing protein | - |
| PPW95_RS15300 (PPW95_15300) | 1411377..1411976 | + | 600 | WP_031856598.1 | cytochrome c oxidase assembly factor Coa1 family protein | - |
| PPW95_RS15305 (PPW95_15305) | 1412111..1412641 | + | 531 | WP_085576757.1 | hypothetical protein | - |
| PPW95_RS15310 (PPW95_15310) | 1412876..1413096 | + | 221 | Protein_1301 | hypothetical protein | - |
| PPW95_RS15315 (PPW95_15315) | 1413268..1413624 | + | 357 | WP_017449618.1 | hypothetical protein | - |
| PPW95_RS15320 (PPW95_15320) | 1413639..1413731 | + | 93 | WP_072600995.1 | DUF3265 domain-containing protein | - |
| PPW95_RS15325 (PPW95_15325) | 1414231..1414509 | - | 279 | WP_031856368.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| PPW95_RS15330 (PPW95_15330) | 1414506..1414790 | - | 285 | WP_005497249.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PPW95_RS15335 (PPW95_15335) | 1415001..1415426 | + | 426 | WP_031856367.1 | hypothetical protein | - |
| PPW95_RS15340 (PPW95_15340) | 1416188..1416463 | + | 276 | WP_031856366.1 | antibiotic biosynthesis monooxygenase | - |
| PPW95_RS15345 (PPW95_15345) | 1416500..1416547 | + | 48 | WP_230768546.1 | hypothetical protein | - |
| PPW95_RS15350 (PPW95_15350) | 1416625..1417254 | + | 630 | WP_031856365.1 | hypothetical protein | - |
| PPW95_RS15355 (PPW95_15355) | 1417274..1417366 | + | 93 | WP_004748931.1 | DUF3265 domain-containing protein | - |
| PPW95_RS15360 (PPW95_15360) | 1417398..1417703 | + | 306 | WP_021453216.1 | hypothetical protein | - |
| PPW95_RS15365 (PPW95_15365) | 1417860..1418348 | + | 489 | WP_031856291.1 | DUF523 domain-containing protein | - |
| PPW95_RS15370 (PPW95_15370) | 1418556..1418963 | + | 408 | WP_025502308.1 | DUF4476 domain-containing protein | - |
| PPW95_RS15375 (PPW95_15375) | 1419621..1419710 | + | 90 | WP_078231685.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 | 1329215..1781847 | 452632 | |
| - | inside | Integron | - | - | 1319803..1443912 | 124109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10915.56 Da Isoelectric Point: 4.4548
>T269910 WP_031856368.1 NZ_CP117039:c1414509-1414231 [Vibrio parahaemolyticus]
MILWEEESLNDREKIFEFLYDFNPEAANKTDDIIEAKVENLLEQPHMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
MILWEEESLNDREKIFEFLYDFNPEAANKTDDIIEAKVENLLEQPHMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|