Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 1323554..1324119 Replicon chromosome
Accession NZ_CP117039
Organism Vibrio parahaemolyticus strain VP220218

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PPW95_RS14470 Protein ID WP_031856567.1
Coordinates 1323832..1324119 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PPW95_RS14465 Protein ID WP_031856568.1
Coordinates 1323554..1323835 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPW95_RS14420 (PPW95_14420) 1318678..1319265 + 588 WP_031856425.1 HD domain-containing protein -
PPW95_RS14425 (PPW95_14425) 1319279..1319752 + 474 WP_005458833.1 DUF2947 domain-containing protein -
PPW95_RS14430 (PPW95_14430) 1319803..1320765 - 963 WP_023623891.1 integron integrase -
PPW95_RS14435 (PPW95_14435) 1321022..1321522 + 501 WP_031856426.1 opioid growth factor receptor-related protein -
PPW95_RS14440 (PPW95_14440) 1321561..1321653 + 93 WP_079880850.1 DUF3265 domain-containing protein -
PPW95_RS14445 (PPW95_14445) 1321681..1322211 + 531 WP_050505289.1 hypothetical protein -
PPW95_RS14450 (PPW95_14450) 1322374..1322697 - 324 WP_168192476.1 hypothetical protein -
PPW95_RS14455 (PPW95_14455) 1322826..1322915 + 90 WP_235801308.1 DUF3265 domain-containing protein -
PPW95_RS14460 (PPW95_14460) 1323334..1323463 + 130 Protein_1132 DUF3265 domain-containing protein -
PPW95_RS14465 (PPW95_14465) 1323554..1323835 + 282 WP_031856568.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PPW95_RS14470 (PPW95_14470) 1323832..1324119 + 288 WP_031856567.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PPW95_RS14475 (PPW95_14475) 1324266..1324538 + 273 WP_031856534.1 nicotinamide mononucleotide transporter -
PPW95_RS14480 (PPW95_14480) 1324570..1324659 + 90 WP_085626715.1 DUF3265 domain-containing protein -
PPW95_RS14485 (PPW95_14485) 1325064..1325207 + 144 WP_140213540.1 DUF3265 domain-containing protein -
PPW95_RS14490 (PPW95_14490) 1325235..1325585 + 351 WP_025502458.1 hypothetical protein -
PPW95_RS14495 (PPW95_14495) 1325615..1325704 + 90 WP_079866498.1 DUF3265 domain-containing protein -
PPW95_RS14500 (PPW95_14500) 1326064..1326192 + 129 WP_108744602.1 DUF3265 domain-containing protein -
PPW95_RS14505 (PPW95_14505) 1326475..1326600 + 126 WP_085576728.1 DUF3265 domain-containing protein -
PPW95_RS14515 (PPW95_14515) 1327732..1328532 + 801 WP_043037961.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 1319803..1443912 124109


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10986.63 Da        Isoelectric Point: 4.6104

>T269909 WP_031856567.1 NZ_CP117039:1323832-1324119 [Vibrio parahaemolyticus]
MKVVWSPLALQKLGDAAEFISLDNPAAAENWINEVFDKTELLGSMPEMGRFVPEMPNTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDL

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10428.93 Da        Isoelectric Point: 5.8650

>AT269909 WP_031856568.1 NZ_CP117039:1323554-1323835 [Vibrio parahaemolyticus]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGISN
DDARSQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References