Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 125008..125609 | Replicon | plasmid IncFIB/IncFIC |
| Accession | NZ_CP117035 | ||
| Organism | Salmonella enterica strain PIW95_S14_0299 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | PQP07_RS26435 | Protein ID | WP_001216034.1 |
| Coordinates | 125229..125609 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PQP07_RS26430 | Protein ID | WP_001190712.1 |
| Coordinates | 125008..125229 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP07_RS26420 (121989) | 121989..123272 | - | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
| PQP07_RS26425 (123269) | 123269..124825 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| PQP07_RS26430 (125008) | 125008..125229 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP07_RS26435 (125229) | 125229..125609 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQP07_RS26440 (125614) | 125614..125793 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| PQP07_RS26445 (125821) | 125821..126099 | + | 279 | Protein_148 | pdcB | - |
| PQP07_RS26450 (126104) | 126104..126517 | + | 414 | Protein_149 | integrase core domain-containing protein | - |
| PQP07_RS26455 (126467) | 126467..126802 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| PQP07_RS26460 (127012) | 127012..127992 | - | 981 | WP_001567628.1 | IS5-like element IS5 family transposase | - |
| PQP07_RS26465 (128236) | 128236..129639 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| PQP07_RS26470 (129626) | 129626..130558 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B | - | 1..133901 | 133901 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T269908 WP_001216034.1 NZ_CP117035:125229-125609 [Salmonella enterica]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |