Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 125008..125609 Replicon plasmid IncFIB/IncFIC
Accession NZ_CP117035
Organism Salmonella enterica strain PIW95_S14_0299

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PQP07_RS26435 Protein ID WP_001216034.1
Coordinates 125229..125609 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PQP07_RS26430 Protein ID WP_001190712.1
Coordinates 125008..125229 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP07_RS26420 (121989) 121989..123272 - 1284 WP_001617890.1 restriction endonuclease subunit S -
PQP07_RS26425 (123269) 123269..124825 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
PQP07_RS26430 (125008) 125008..125229 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP07_RS26435 (125229) 125229..125609 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP07_RS26440 (125614) 125614..125793 + 180 WP_001513661.1 hypothetical protein -
PQP07_RS26445 (125821) 125821..126099 + 279 Protein_148 pdcB -
PQP07_RS26450 (126104) 126104..126517 + 414 Protein_149 integrase core domain-containing protein -
PQP07_RS26455 (126467) 126467..126802 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
PQP07_RS26460 (127012) 127012..127992 - 981 WP_001567628.1 IS5-like element IS5 family transposase -
PQP07_RS26465 (128236) 128236..129639 + 1404 WP_001373486.1 S-methylmethionine permease -
PQP07_RS26470 (129626) 129626..130558 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B - 1..133901 133901


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T269908 WP_001216034.1 NZ_CP117035:125229-125609 [Salmonella enterica]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269908 WP_001190712.1 NZ_CP117035:125008-125229 [Salmonella enterica]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References