Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 112364..113007 | Replicon | plasmid IncFIB/IncFIC |
Accession | NZ_CP117035 | ||
Organism | Salmonella enterica strain PIW95_S14_0299 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | PQP07_RS26390 | Protein ID | WP_001044768.1 |
Coordinates | 112591..113007 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | PQP07_RS26385 | Protein ID | WP_001261287.1 |
Coordinates | 112364..112594 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP07_RS26360 (107604) | 107604..108824 | - | 1221 | WP_208217341.1 | hypothetical protein | - |
PQP07_RS26370 (110209) | 110209..110577 | - | 369 | WP_243765465.1 | hypothetical protein | - |
PQP07_RS26375 (110628) | 110628..111458 | - | 831 | WP_223201786.1 | hypothetical protein | - |
PQP07_RS26380 (111510) | 111510..112058 | - | 549 | WP_039002808.1 | hypothetical protein | - |
PQP07_RS26385 (112364) | 112364..112594 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PQP07_RS26390 (112591) | 112591..113007 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQP07_RS26395 (113169) | 113169..115307 | - | 2139 | WP_039002805.1 | AAA family ATPase | - |
PQP07_RS26400 (115772) | 115772..116767 | + | 996 | WP_000246636.1 | hypothetical protein | - |
PQP07_RS26405 (116810) | 116810..117703 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B | - | 1..133901 | 133901 | |
- | flank | IS/Tn | - | - | 117840..118217 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T269907 WP_001044768.1 NZ_CP117035:112591-113007 [Salmonella enterica]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |