Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 37823..38358 Replicon plasmid IncFIB/IncFIC
Accession NZ_CP117035
Organism Salmonella enterica strain PIW95_S14_0299

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag PQP07_RS25920 Protein ID WP_000222766.1
Coordinates 37823..38110 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag PQP07_RS25925 Protein ID WP_001132900.1
Coordinates 38107..38358 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP07_RS25900 (33266) 33266..33823 - 558 WP_001235713.1 recombinase family protein -
PQP07_RS25905 (33987) 33987..36992 + 3006 WP_001143760.1 Tn3-like element Tn3 family transposase -
PQP07_RS25910 (37026) 37026..37526 + 501 Protein_41 Tn3 family transposase -
PQP07_RS25915 (37560) 37560..37748 + 189 Protein_42 IS3 family transposase -
PQP07_RS25920 (37823) 37823..38110 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP07_RS25925 (38107) 38107..38358 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP07_RS25930 (39324) 39324..40181 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
PQP07_RS25935 (40174) 40174..40248 - 75 WP_061357229.1 RepA leader peptide Tap -
PQP07_RS25940 (40480) 40480..40737 - 258 WP_001541895.1 replication regulatory protein RepA -
PQP07_RS25945 (41005) 41005..41154 - 150 WP_001312851.1 Hok/Gef family protein -
- (41198) 41198..41259 + 62 NuclAT_1 - -
- (41198) 41198..41259 + 62 NuclAT_1 - -
- (41198) 41198..41259 + 62 NuclAT_1 - -
- (41198) 41198..41259 + 62 NuclAT_1 - -
PQP07_RS25950 (41601) 41601..41813 - 213 WP_001541896.1 ANR family transcriptional regulator -
PQP07_RS25955 (41948) 41948..42508 - 561 WP_000139310.1 fertility inhibition protein FinO -
PQP07_RS25960 (42563) 42563..43306 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B - 1..133901 133901


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T269899 WP_000222766.1 NZ_CP117035:c38110-37823 [Salmonella enterica]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT269899 WP_001132900.1 NZ_CP117035:c38358-38107 [Salmonella enterica]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References