Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4480845..4481626 | Replicon | chromosome |
| Accession | NZ_CP117033 | ||
| Organism | Salmonella enterica strain PIW95_S14_0299 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | E8X9W8 |
| Locus tag | PQP07_RS22135 | Protein ID | WP_000626099.1 |
| Coordinates | 4480845..4481336 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | PQP07_RS22140 | Protein ID | WP_001110452.1 |
| Coordinates | 4481333..4481626 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP07_RS22095 (4476031) | 4476031..4476273 | - | 243 | WP_197603740.1 | hypothetical protein | - |
| PQP07_RS22100 (4476270) | 4476270..4476626 | - | 357 | WP_033567083.1 | hypothetical protein | - |
| PQP07_RS22105 (4476623) | 4476623..4477495 | - | 873 | WP_033567082.1 | ParA family protein | - |
| PQP07_RS22110 (4477686) | 4477686..4477763 | - | 78 | Protein_4327 | helix-turn-helix domain-containing protein | - |
| PQP07_RS22115 (4477854) | 4477854..4478186 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
| PQP07_RS22120 (4478258) | 4478258..4478635 | + | 378 | WP_000916345.1 | EthD family reductase | - |
| PQP07_RS22125 (4479668) | 4479668..4479742 | + | 75 | Protein_4330 | porin family protein | - |
| PQP07_RS22130 (4479845) | 4479845..4480597 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
| PQP07_RS22135 (4480845) | 4480845..4481336 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
| PQP07_RS22140 (4481333) | 4481333..4481626 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| PQP07_RS22145 (4481943) | 4481943..4482164 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| PQP07_RS22150 (4482429) | 4482429..4483304 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| PQP07_RS22155 (4483301) | 4483301..4483588 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| PQP07_RS22160 (4483611) | 4483611..4483826 | + | 216 | WP_001595136.1 | hypothetical protein | - |
| PQP07_RS22165 (4483834) | 4483834..4484103 | + | 270 | WP_010989096.1 | hypothetical protein | - |
| PQP07_RS22170 (4484397) | 4484397..4485302 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T269895 WP_000626099.1 NZ_CP117033:c4481336-4480845 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |