Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3514774..3515394 | Replicon | chromosome |
Accession | NZ_CP117033 | ||
Organism | Salmonella enterica strain PIW95_S14_0299 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP07_RS17415 | Protein ID | WP_001280991.1 |
Coordinates | 3515176..3515394 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP07_RS17410 | Protein ID | WP_000344807.1 |
Coordinates | 3514774..3515148 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP07_RS17400 (3509913) | 3509913..3511106 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP07_RS17405 (3511129) | 3511129..3514278 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP07_RS17410 (3514774) | 3514774..3515148 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP07_RS17415 (3515176) | 3515176..3515394 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP07_RS17420 (3515573) | 3515573..3516124 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQP07_RS17425 (3516241) | 3516241..3516711 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQP07_RS17430 (3516767) | 3516767..3516907 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP07_RS17435 (3516913) | 3516913..3517173 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP07_RS17440 (3517398) | 3517398..3518948 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQP07_RS17450 (3519179) | 3519179..3519568 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP07_RS17455 (3519601) | 3519601..3520170 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T269890 WP_001280991.1 NZ_CP117033:3515176-3515394 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT269890 WP_000344807.1 NZ_CP117033:3514774-3515148 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|