Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 2144690..2145338 | Replicon | chromosome |
Accession | NZ_CP117029 | ||
Organism | Vibrio tubiashii strain FP17 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | LYZ37_RS09730 | Protein ID | WP_272785357.1 |
Coordinates | 2144690..2145112 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | LYZ37_RS09735 | Protein ID | WP_272785358.1 |
Coordinates | 2145105..2145338 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LYZ37_RS09700 (LYZ37_09700) | 2140288..2140644 | - | 357 | WP_272785352.1 | hypothetical protein | - |
LYZ37_RS09705 (LYZ37_09705) | 2140731..2141081 | - | 351 | WP_272785353.1 | DUF3147 family protein | - |
LYZ37_RS09710 (LYZ37_09710) | 2141134..2142210 | - | 1077 | WP_272785354.1 | nickel/cobalt efflux protein RcnA | - |
LYZ37_RS09715 (LYZ37_09715) | 2142345..2142617 | + | 273 | WP_069666778.1 | Ni(II)/Co(II)-binding transcriptional repressor RcnR | - |
LYZ37_RS09720 (LYZ37_09720) | 2142689..2143750 | - | 1062 | WP_272785355.1 | protease SohB | - |
LYZ37_RS09725 (LYZ37_09725) | 2143840..2144583 | + | 744 | WP_272785356.1 | YciK family oxidoreductase | - |
LYZ37_RS09730 (LYZ37_09730) | 2144690..2145112 | - | 423 | WP_272785357.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LYZ37_RS09735 (LYZ37_09735) | 2145105..2145338 | - | 234 | WP_272785358.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LYZ37_RS09740 (LYZ37_09740) | 2145549..2146226 | + | 678 | WP_239825416.1 | translesion DNA synthesis-associated protein ImuA | - |
LYZ37_RS09745 (LYZ37_09745) | 2146229..2147629 | + | 1401 | WP_272785359.1 | DNA polymerase Y family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15667.40 Da Isoelectric Point: 9.5032
>T269878 WP_272785357.1 NZ_CP117029:c2145112-2144690 [Vibrio tubiashii]
MSKKINYMLDTCICSFIMREQPITVLKKLQAVVGKQHRIVISAITYQEMQYGLLGKKASQKHKVLVEAFLKRVDEILPWD
KAAVDATTEVKRDLMAKGTPIGSNDTAIAGHAIAAGCVLVTNNTREFQRVEGLKLEDWVH
MSKKINYMLDTCICSFIMREQPITVLKKLQAVVGKQHRIVISAITYQEMQYGLLGKKASQKHKVLVEAFLKRVDEILPWD
KAAVDATTEVKRDLMAKGTPIGSNDTAIAGHAIAAGCVLVTNNTREFQRVEGLKLEDWVH
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|