Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 1637172..1637688 Replicon chromosome
Accession NZ_CP117029
Organism Vibrio tubiashii strain FP17

Toxin (Protein)


Gene name relB Uniprot ID -
Locus tag LYZ37_RS07475 Protein ID WP_272787110.1
Coordinates 1637172..1637441 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag LYZ37_RS07480 Protein ID WP_272787111.1
Coordinates 1637434..1637688 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LYZ37_RS07445 (LYZ37_07445) 1633373..1633906 - 534 WP_272787106.1 lipocalin family protein -
LYZ37_RS07450 (LYZ37_07450) 1633940..1634437 - 498 WP_272787107.1 GNAT family N-acetyltransferase -
LYZ37_RS07455 (LYZ37_07455) 1634506..1634934 - 429 WP_239825822.1 hypothetical protein -
LYZ37_RS07460 (LYZ37_07460) 1635077..1635694 - 618 WP_272787108.1 LysE family translocator -
LYZ37_RS07465 (LYZ37_07465) 1635841..1636176 - 336 WP_272787109.1 hypothetical protein -
LYZ37_RS07470 (LYZ37_07470) 1636173..1637018 - 846 WP_272787151.1 NAD(P)-dependent oxidoreductase -
LYZ37_RS07475 (LYZ37_07475) 1637172..1637441 - 270 WP_272787110.1 Txe/YoeB family addiction module toxin Toxin
LYZ37_RS07480 (LYZ37_07480) 1637434..1637688 - 255 WP_272787111.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
LYZ37_RS07485 (LYZ37_07485) 1637900..1638289 - 390 WP_272787112.1 hypothetical protein -
LYZ37_RS07490 (LYZ37_07490) 1638430..1638702 - 273 WP_272787113.1 hypothetical protein -
LYZ37_RS07495 (LYZ37_07495) 1638730..1638822 - 93 WP_071652181.1 DUF3265 domain-containing protein -
LYZ37_RS07500 (LYZ37_07500) 1638837..1639193 - 357 WP_017449618.1 hypothetical protein -
LYZ37_RS07505 (LYZ37_07505) 1639411..1640085 + 675 WP_272787114.1 hypothetical protein -
LYZ37_RS07510 (LYZ37_07510) 1640117..1640272 - 156 WP_272787115.1 hypothetical protein -
LYZ37_RS07515 (LYZ37_07515) 1640293..1640436 + 144 WP_272787116.1 hypothetical protein -
LYZ37_RS07520 (LYZ37_07520) 1640719..1641102 - 384 WP_272787117.1 hypothetical protein -
LYZ37_RS07525 (LYZ37_07525) 1641252..1641791 - 540 WP_272787118.1 hypothetical protein -
LYZ37_RS07530 (LYZ37_07530) 1642075..1642338 + 264 WP_272787119.1 DUF1496 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - VP1611 1512049..1673464 161415
- inside Integron - - 1636173..1643760 7587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-89)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10541.95 Da        Isoelectric Point: 8.8578

>T269877 WP_272787110.1 NZ_CP117029:c1637441-1637172 [Vibrio tubiashii]
MSSSLRLLSWTDDAWGDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY

Download         Length: 270 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9497.57 Da        Isoelectric Point: 4.5700

>AT269877 WP_272787111.1 NZ_CP117029:c1637688-1637434 [Vibrio tubiashii]
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNAEHLNRSIAQYRAGQTTERD
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References