Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 3050482..3051067 | Replicon | chromosome |
| Accession | NZ_CP117025 | ||
| Organism | Sphingomonas hankookensis strain SZ.B2R2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PPZ50_RS14420 | Protein ID | WP_272815365.1 |
| Coordinates | 3050738..3051067 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PPZ50_RS14415 | Protein ID | WP_272815364.1 |
| Coordinates | 3050482..3050745 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPZ50_RS14400 (PPZ50_14380) | 3045961..3047853 | + | 1893 | WP_272815362.1 | hypothetical protein | - |
| PPZ50_RS14405 (PPZ50_14385) | 3047892..3049403 | + | 1512 | WP_272815363.1 | IS21 family transposase | - |
| PPZ50_RS14410 (PPZ50_14390) | 3049390..3050118 | + | 729 | WP_066691143.1 | IS21-like element helper ATPase IstB | - |
| PPZ50_RS14415 (PPZ50_14395) | 3050482..3050745 | + | 264 | WP_272815364.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PPZ50_RS14420 (PPZ50_14400) | 3050738..3051067 | + | 330 | WP_272815365.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PPZ50_RS14425 (PPZ50_14405) | 3051073..3053109 | - | 2037 | WP_272815366.1 | hypothetical protein | - |
| PPZ50_RS14430 (PPZ50_14410) | 3053394..3053612 | - | 219 | WP_272815367.1 | hypothetical protein | - |
| PPZ50_RS14435 (PPZ50_14415) | 3053873..3054589 | + | 717 | WP_272815368.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3034942..3094687 | 59745 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11974.61 Da Isoelectric Point: 9.0928
>T269876 WP_272815365.1 NZ_CP117025:3050738-3051067 [Sphingomonas hankookensis]
MAKGAQTKRASHPRACDYTKAFSKDWARLSGSGRYDMNRLKAVMLLLIANDAPLGPEWKDHPLKGEWSSHRECHVGGDFL
LIYKTDDGAGKGGTIVFVRAGTHADLFGE
MAKGAQTKRASHPRACDYTKAFSKDWARLSGSGRYDMNRLKAVMLLLIANDAPLGPEWKDHPLKGEWSSHRECHVGGDFL
LIYKTDDGAGKGGTIVFVRAGTHADLFGE
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|