Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-doc |
| Location | 2697321..2697931 | Replicon | chromosome |
| Accession | NZ_CP117025 | ||
| Organism | Sphingomonas hankookensis strain SZ.B2R2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A430E7G1 |
| Locus tag | PPZ50_RS12770 | Protein ID | WP_066694113.1 |
| Coordinates | 2697321..2697719 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A430E7B9 |
| Locus tag | PPZ50_RS12775 | Protein ID | WP_066694115.1 |
| Coordinates | 2697716..2697931 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPZ50_RS12735 (PPZ50_12715) | 2692791..2693267 | + | 477 | WP_232308064.1 | MarR family transcriptional regulator | - |
| PPZ50_RS12740 (PPZ50_12720) | 2693377..2694183 | - | 807 | WP_066694104.1 | pyrroline-5-carboxylate reductase | - |
| PPZ50_RS12745 (PPZ50_12725) | 2694180..2694680 | - | 501 | WP_066694106.1 | YbjN domain-containing protein | - |
| PPZ50_RS12750 (PPZ50_12730) | 2694747..2695046 | - | 300 | WP_066694108.1 | accessory factor UbiK family protein | - |
| PPZ50_RS12755 (PPZ50_12735) | 2695093..2695647 | - | 555 | WP_066694110.1 | TspO/MBR family protein | - |
| PPZ50_RS12760 (PPZ50_12740) | 2695687..2696475 | - | 789 | WP_198158625.1 | TlyA family RNA methyltransferase | - |
| PPZ50_RS12765 (PPZ50_12745) | 2696656..2697324 | + | 669 | WP_066694544.1 | alpha/beta hydrolase | - |
| PPZ50_RS12770 (PPZ50_12750) | 2697321..2697719 | - | 399 | WP_066694113.1 | PIN domain-containing protein | Toxin |
| PPZ50_RS12775 (PPZ50_12755) | 2697716..2697931 | - | 216 | WP_066694115.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PPZ50_RS12780 (PPZ50_12760) | 2697956..2698375 | - | 420 | WP_066694117.1 | hypothetical protein | - |
| PPZ50_RS12785 (PPZ50_12765) | 2698372..2700294 | - | 1923 | WP_066694118.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| PPZ50_RS12790 (PPZ50_12770) | 2700381..2700842 | - | 462 | WP_066694123.1 | Fur family transcriptional regulator | - |
| PPZ50_RS12795 (PPZ50_12775) | 2700883..2701263 | - | 381 | WP_066694550.1 | MerC domain-containing protein | - |
| PPZ50_RS12800 (PPZ50_12780) | 2701371..2701637 | - | 267 | WP_066694125.1 | UvrB/UvrC motif-containing protein | - |
| PPZ50_RS12805 (PPZ50_12785) | 2701669..2701986 | - | 318 | WP_066694128.1 | DUF2218 domain-containing protein | - |
| PPZ50_RS12810 (PPZ50_12790) | 2701983..2702525 | - | 543 | WP_066694552.1 | PadR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14756.01 Da Isoelectric Point: 6.6355
>T269875 WP_066694113.1 NZ_CP117025:c2697719-2697321 [Sphingomonas hankookensis]
MSVAFFDTNILVYALGVDDRAIRAQSLLADGGIISVQSLNEFATVTRRKLRYEWPAIHDALAALRVLCPHIVPLTDAIHR
DGLRIAERYRLSIYDSMISAAALSAGCDRLWSEDLHHGLVIDARLEVRNPFL
MSVAFFDTNILVYALGVDDRAIRAQSLLADGGIISVQSLNEFATVTRRKLRYEWPAIHDALAALRVLCPHIVPLTDAIHR
DGLRIAERYRLSIYDSMISAAALSAGCDRLWSEDLHHGLVIDARLEVRNPFL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A430E7G1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A430E7B9 |