269875

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-doc
Location 2697321..2697931 Replicon chromosome
Accession NZ_CP117025
Organism Sphingomonas hankookensis strain SZ.B2R2

Toxin (Protein)


Gene name vapC Uniprot ID A0A430E7G1
Locus tag PPZ50_RS12770 Protein ID WP_066694113.1
Coordinates 2697321..2697719 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A430E7B9
Locus tag PPZ50_RS12775 Protein ID WP_066694115.1
Coordinates 2697716..2697931 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPZ50_RS12735 (PPZ50_12715) 2692791..2693267 + 477 WP_232308064.1 MarR family transcriptional regulator -
PPZ50_RS12740 (PPZ50_12720) 2693377..2694183 - 807 WP_066694104.1 pyrroline-5-carboxylate reductase -
PPZ50_RS12745 (PPZ50_12725) 2694180..2694680 - 501 WP_066694106.1 YbjN domain-containing protein -
PPZ50_RS12750 (PPZ50_12730) 2694747..2695046 - 300 WP_066694108.1 accessory factor UbiK family protein -
PPZ50_RS12755 (PPZ50_12735) 2695093..2695647 - 555 WP_066694110.1 TspO/MBR family protein -
PPZ50_RS12760 (PPZ50_12740) 2695687..2696475 - 789 WP_198158625.1 TlyA family RNA methyltransferase -
PPZ50_RS12765 (PPZ50_12745) 2696656..2697324 + 669 WP_066694544.1 alpha/beta hydrolase -
PPZ50_RS12770 (PPZ50_12750) 2697321..2697719 - 399 WP_066694113.1 PIN domain-containing protein Toxin
PPZ50_RS12775 (PPZ50_12755) 2697716..2697931 - 216 WP_066694115.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PPZ50_RS12780 (PPZ50_12760) 2697956..2698375 - 420 WP_066694117.1 hypothetical protein -
PPZ50_RS12785 (PPZ50_12765) 2698372..2700294 - 1923 WP_066694118.1 1-deoxy-D-xylulose-5-phosphate synthase -
PPZ50_RS12790 (PPZ50_12770) 2700381..2700842 - 462 WP_066694123.1 Fur family transcriptional regulator -
PPZ50_RS12795 (PPZ50_12775) 2700883..2701263 - 381 WP_066694550.1 MerC domain-containing protein -
PPZ50_RS12800 (PPZ50_12780) 2701371..2701637 - 267 WP_066694125.1 UvrB/UvrC motif-containing protein -
PPZ50_RS12805 (PPZ50_12785) 2701669..2701986 - 318 WP_066694128.1 DUF2218 domain-containing protein -
PPZ50_RS12810 (PPZ50_12790) 2701983..2702525 - 543 WP_066694552.1 PadR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-115)

Antitoxin

SpoVT-AbrB domain

(5-37)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14756.01 Da        Isoelectric Point: 6.6355

>T269875 WP_066694113.1 NZ_CP117025:c2697719-2697321 [Sphingomonas hankookensis]
MSVAFFDTNILVYALGVDDRAIRAQSLLADGGIISVQSLNEFATVTRRKLRYEWPAIHDALAALRVLCPHIVPLTDAIHR
DGLRIAERYRLSIYDSMISAAALSAGCDRLWSEDLHHGLVIDARLEVRNPFL

Download         Length: 399 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7768.81 Da        Isoelectric Point: 4.7672

>AT269875 WP_066694115.1 NZ_CP117025:c2697931-2697716 [Sphingomonas hankookensis]
VKVEKIGDQLAIVIPQDVAETLGLHEGDSVEVRRSSDPAPMTRDEAIAAMRALARPLPPGYKFDREEANAR

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A430E7G1

Antitoxin

Source ID Structure
AlphaFold DB A0A430E7B9

References