Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | VapD-relB/- |
Location | 188734..189391 | Replicon | chromosome |
Accession | NZ_CP117024 | ||
Organism | Helicobacter pylori strain 444A6 |
Toxin (Protein)
Gene name | VapD | Uniprot ID | I9U8Q7 |
Locus tag | PPK11_RS00910 | Protein ID | WP_000271055.1 |
Coordinates | 189107..189391 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PPK11_RS00905 | Protein ID | WP_273898209.1 |
Coordinates | 188734..189126 (+) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPK11_RS00885 (183925) | 183925..185038 | + | 1114 | Protein_159 | hydrogenase formation protein HypD | - |
PPK11_RS00900 (186018) | 186018..188132 | + | 2115 | WP_273898208.1 | outer membrane beta-barrel protein | - |
PPK11_RS00905 (188734) | 188734..189126 | + | 393 | WP_273898209.1 | hypothetical protein | Antitoxin |
PPK11_RS00910 (189107) | 189107..189391 | + | 285 | WP_000271055.1 | endoribonuclease VapD | Toxin |
PPK11_RS00915 (189590) | 189590..190114 | - | 525 | WP_001135632.1 | acyl-CoA thioesterase | - |
PPK11_RS00920 (190254) | 190254..191108 | + | 855 | WP_273898212.1 | SDR family oxidoreductase | - |
PPK11_RS00925 (191101) | 191101..192081 | + | 981 | WP_000921461.1 | iron ABC transporter permease | - |
PPK11_RS00930 (192081) | 192081..192848 | + | 768 | WP_108356873.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11215.81 Da Isoelectric Point: 5.2187
>T269874 WP_000271055.1 NZ_CP117024:189107-189391 [Helicobacter pylori]
MYALAFDLKIEILKKEYKEPYNKAYDDLRQELELLGFENTQGSVYVNYSKENTLVQVYKAINKLSQIEWFKKSVRDIRAF
KVEDFSDFTEIVKS
MYALAFDLKIEILKKEYKEPYNKAYDDLRQELELLGFENTQGSVYVNYSKENTLVQVYKAINKLSQIEWFKKSVRDIRAF
KVEDFSDFTEIVKS
Download Length: 285 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 15273.42 Da Isoelectric Point: 8.7031
>AT269874 WP_273898209.1 NZ_CP117024:188734-189126 [Helicobacter pylori]
MPNTTAKKDYTKYSEKQLFNLIHQLERKIKKMQNDRVSFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDAVNGVNLTQIDSLDDLTNELKRENNKGFENVCFSV
MPNTTAKKDYTKYSEKQLFNLIHQLERKIKKMQNDRVSFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDAVNGVNLTQIDSLDDLTNELKRENNKGFENVCFSV
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|