Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 4844046..4844751 | Replicon | chromosome |
Accession | NZ_CP117020 | ||
Organism | Escherichia coli strain MLI106K3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NL424_RS23425 | Protein ID | WP_000539521.1 |
Coordinates | 4844365..4844751 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NL424_RS23420 | Protein ID | WP_001280945.1 |
Coordinates | 4844046..4844375 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL424_RS23405 (4839203) | 4839203..4840114 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
NL424_RS23410 (4840292) | 4840292..4842640 | + | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
NL424_RS23415 (4842648) | 4842648..4843976 | + | 1329 | WP_049068068.1 | GGDEF domain-containing protein | - |
NL424_RS23420 (4844046) | 4844046..4844375 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NL424_RS23425 (4844365) | 4844365..4844751 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL424_RS23430 (4844977) | 4844977..4846302 | - | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NL424_RS23435 (4846515) | 4846515..4846898 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NL424_RS23440 (4847009) | 4847009..4848124 | + | 1116 | WP_001595547.1 | aldose sugar dehydrogenase YliI | - |
NL424_RS23445 (4848121) | 4848121..4848747 | - | 627 | WP_001595548.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T269872 WP_000539521.1 NZ_CP117020:c4844751-4844365 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|