Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3758664..3759496 Replicon chromosome
Accession NZ_CP117020
Organism Escherichia coli strain MLI106K3

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL424_RS18430 Protein ID WP_000854765.1
Coordinates 3759122..3759496 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL424_RS18425 Protein ID WP_001295723.1
Coordinates 3758664..3759032 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL424_RS18395 (3755776) 3755776..3755971 + 196 Protein_3515 DUF905 family protein -
NL424_RS18400 (3756089) 3756089..3756907 + 819 WP_001234716.1 DUF932 domain-containing protein -
NL424_RS18405 (3756907) 3756907..3757080 + 174 WP_001183321.1 hypothetical protein -
NL424_RS18410 (3757246) 3757246..3757719 + 474 WP_001387789.1 antirestriction protein -
NL424_RS18415 (3757735) 3757735..3758211 + 477 WP_001354275.1 RadC family protein -
NL424_RS18420 (3758280) 3758280..3758501 + 222 WP_000692345.1 DUF987 domain-containing protein -
NL424_RS18425 (3758664) 3758664..3759032 + 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL424_RS18430 (3759122) 3759122..3759496 + 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL424_RS18435 (3759493) 3759493..3759579 + 87 Protein_3523 DUF5983 family protein -
NL424_RS18440 (3759773) 3759773..3761314 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NL424_RS18445 (3761329) 3761329..3762075 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NL424_RS18450 (3762160) 3762160..3762570 + 411 Protein_3526 DUF5983 family protein -
NL424_RS18455 (3762587) 3762587..3762763 + 177 WP_001586605.1 DUF957 domain-containing protein -
NL424_RS18460 (3762869) 3762869..3763018 + 150 Protein_3528 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269867 WP_000854765.1 NZ_CP117020:3759122-3759496 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269867 WP_001295723.1 NZ_CP117020:3758664-3759032 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References