Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3758664..3759496 | Replicon | chromosome |
| Accession | NZ_CP117020 | ||
| Organism | Escherichia coli strain MLI106K3 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | NL424_RS18430 | Protein ID | WP_000854765.1 |
| Coordinates | 3759122..3759496 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL424_RS18425 | Protein ID | WP_001295723.1 |
| Coordinates | 3758664..3759032 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL424_RS18395 (3755776) | 3755776..3755971 | + | 196 | Protein_3515 | DUF905 family protein | - |
| NL424_RS18400 (3756089) | 3756089..3756907 | + | 819 | WP_001234716.1 | DUF932 domain-containing protein | - |
| NL424_RS18405 (3756907) | 3756907..3757080 | + | 174 | WP_001183321.1 | hypothetical protein | - |
| NL424_RS18410 (3757246) | 3757246..3757719 | + | 474 | WP_001387789.1 | antirestriction protein | - |
| NL424_RS18415 (3757735) | 3757735..3758211 | + | 477 | WP_001354275.1 | RadC family protein | - |
| NL424_RS18420 (3758280) | 3758280..3758501 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL424_RS18425 (3758664) | 3758664..3759032 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL424_RS18430 (3759122) | 3759122..3759496 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| NL424_RS18435 (3759493) | 3759493..3759579 | + | 87 | Protein_3523 | DUF5983 family protein | - |
| NL424_RS18440 (3759773) | 3759773..3761314 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| NL424_RS18445 (3761329) | 3761329..3762075 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| NL424_RS18450 (3762160) | 3762160..3762570 | + | 411 | Protein_3526 | DUF5983 family protein | - |
| NL424_RS18455 (3762587) | 3762587..3762763 | + | 177 | WP_001586605.1 | DUF957 domain-containing protein | - |
| NL424_RS18460 (3762869) | 3762869..3763018 | + | 150 | Protein_3528 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T269867 WP_000854765.1 NZ_CP117020:3759122-3759496 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269867 WP_001295723.1 NZ_CP117020:3758664-3759032 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|