Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2145908..2146562 | Replicon | chromosome |
Accession | NZ_CP117020 | ||
Organism | Escherichia coli strain MLI106K3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NL424_RS10710 | Protein ID | WP_000244781.1 |
Coordinates | 2145908..2146315 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL424_RS10715 | Protein ID | WP_000354046.1 |
Coordinates | 2146296..2146562 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL424_RS10690 (2141865) | 2141865..2143598 | - | 1734 | WP_001598594.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NL424_RS10695 (2143604) | 2143604..2144314 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL424_RS10700 (2144339) | 2144339..2145235 | - | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
NL424_RS10705 (2145347) | 2145347..2145868 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NL424_RS10710 (2145908) | 2145908..2146315 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
NL424_RS10715 (2146296) | 2146296..2146562 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL424_RS10720 (2146805) | 2146805..2147785 | + | 981 | WP_001562036.1 | tRNA-modifying protein YgfZ | - |
NL424_RS10725 (2147862) | 2147862..2148521 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
NL424_RS10730 (2148685) | 2148685..2148996 | - | 312 | WP_001598596.1 | N(4)-acetylcytidine aminohydrolase | - |
NL424_RS10735 (2149041) | 2149041..2150474 | + | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269863 WP_000244781.1 NZ_CP117020:c2146315-2145908 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|