Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 5015899..5016694 | Replicon | chromosome |
| Accession | NZ_CP117016 | ||
| Organism | Escherichia coli strain MLI121 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7UP43 |
| Locus tag | NL415_RS24910 | Protein ID | WP_000854914.1 |
| Coordinates | 5016320..5016694 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | NL415_RS24905 | Protein ID | WP_001280955.1 |
| Coordinates | 5015899..5016273 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL415_RS24875 (5012697) | 5012697..5013152 | + | 456 | WP_000581506.1 | IrmA family protein | - |
| NL415_RS24880 (5013253) | 5013253..5013461 | + | 209 | Protein_4725 | DUF905 family protein | - |
| NL415_RS24885 (5013562) | 5013562..5014383 | + | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| NL415_RS24890 (5014475) | 5014475..5014960 | + | 486 | WP_000214307.1 | antirestriction protein | - |
| NL415_RS24895 (5014976) | 5014976..5015452 | + | 477 | WP_001186726.1 | RadC family protein | - |
| NL415_RS24900 (5015515) | 5015515..5015736 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| NL415_RS24905 (5015899) | 5015899..5016273 | + | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL415_RS24910 (5016320) | 5016320..5016694 | + | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
| NL415_RS24915 (5016691) | 5016691..5017182 | + | 492 | WP_000976857.1 | DUF5983 family protein | - |
| NL415_RS24920 (5017194) | 5017194..5017391 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| NL415_RS24925 (5017476) | 5017476..5018318 | + | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
| NL415_RS24935 (5018789) | 5018789..5019727 | + | 939 | WP_000351297.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| NL415_RS24940 (5019782) | 5019782..5020519 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| NL415_RS24945 (5020543) | 5020543..5021097 | + | 555 | WP_001001926.1 | molecular chaperone YcdY | - |
| NL415_RS24950 (5021199) | 5021199..5021690 | + | 492 | WP_032159295.1 | DUF1097 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T269846 WP_000854914.1 NZ_CP117016:5016320-5016694 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT269846 WP_001280955.1 NZ_CP117016:5015899-5016273 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LXR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9P0D0 |