Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4302691..4303309 | Replicon | chromosome |
| Accession | NZ_CP117016 | ||
| Organism | Escherichia coli strain MLI121 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NL415_RS21555 | Protein ID | WP_001291435.1 |
| Coordinates | 4302691..4302909 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NL415_RS21560 | Protein ID | WP_000344800.1 |
| Coordinates | 4302935..4303309 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL415_RS21520 (4297980) | 4297980..4298552 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| NL415_RS21525 (4298583) | 4298583..4298894 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| NL415_RS21535 (4299273) | 4299273..4299626 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NL415_RS21540 (4299668) | 4299668..4301218 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NL415_RS21545 (4301382) | 4301382..4301852 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NL415_RS21550 (4301968) | 4301968..4302519 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NL415_RS21555 (4302691) | 4302691..4302909 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NL415_RS21560 (4302935) | 4302935..4303309 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NL415_RS21565 (4303855) | 4303855..4307004 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NL415_RS21570 (4307027) | 4307027..4308220 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269844 WP_001291435.1 NZ_CP117016:c4302909-4302691 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269844 WP_000344800.1 NZ_CP117016:c4303309-4302935 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |