Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3615283..3616115 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A7ZVJ9 |
Locus tag | NL415_RS18285 | Protein ID | WP_000854765.1 |
Coordinates | 3615741..3616115 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | NL415_RS18280 | Protein ID | WP_001295723.1 |
Coordinates | 3615283..3615651 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS18255 (3612398) | 3612398..3612593 | + | 196 | Protein_3432 | DUF905 family protein | - |
NL415_RS18260 (3612711) | 3612711..3613529 | + | 819 | WP_001234652.1 | DUF932 domain-containing protein | - |
NL415_RS18265 (3613871) | 3613871..3614344 | + | 474 | WP_000855059.1 | antirestriction protein | - |
NL415_RS18270 (3614360) | 3614360..3614836 | + | 477 | WP_001186775.1 | RadC family protein | - |
NL415_RS18275 (3614899) | 3614899..3615120 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
NL415_RS18280 (3615283) | 3615283..3615651 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL415_RS18285 (3615741) | 3615741..3616115 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
NL415_RS18290 (3616112) | 3616112..3616603 | + | 492 | WP_000976842.1 | DUF5983 family protein | - |
NL415_RS18295 (3616620) | 3616620..3616796 | + | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
NL415_RS18300 (3616902) | 3616902..3617051 | + | 150 | Protein_3441 | hypothetical protein | - |
NL415_RS18305 (3617707) | 3617707..3620598 | + | 2892 | WP_000580534.1 | SNF2-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T269841 WP_000854765.1 NZ_CP117016:3615741-3616115 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269841 WP_001295723.1 NZ_CP117016:3615283-3615651 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|