Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3522020..3522542 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | NL415_RS17795 | Protein ID | WP_001105433.1 |
Coordinates | 3522252..3522542 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | NL415_RS17790 | Protein ID | WP_000212715.1 |
Coordinates | 3522020..3522262 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS17770 (3517736) | 3517736..3519109 | + | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
NL415_RS17775 (3519261) | 3519261..3519812 | - | 552 | WP_000166295.1 | ribosome biogenesis factor YjgA | - |
NL415_RS17780 (3519906) | 3519906..3521258 | + | 1353 | WP_001162171.1 | metalloprotease PmbA | - |
NL415_RS17785 (3521442) | 3521442..3521828 | + | 387 | WP_001232246.1 | cytochrome b562 | - |
NL415_RS17790 (3522020) | 3522020..3522262 | + | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL415_RS17795 (3522252) | 3522252..3522542 | + | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL415_RS17800 (3522543) | 3522543..3523007 | - | 465 | WP_001106233.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL415_RS17805 (3523165) | 3523165..3525303 | - | 2139 | WP_000187799.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL415_RS17810 (3525697) | 3525697..3527352 | - | 1656 | WP_001392998.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T269840 WP_001105433.1 NZ_CP117016:3522252-3522542 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |