Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3510406..3511001 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | NL415_RS17735 | Protein ID | WP_000239581.1 |
Coordinates | 3510651..3511001 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | NL415_RS17730 | Protein ID | WP_001223213.1 |
Coordinates | 3510406..3510657 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS17720 (3506071) | 3506071..3509850 | + | 3780 | WP_000060909.1 | autotransporter assembly complex protein TamB | - |
NL415_RS17725 (3509853) | 3509853..3510194 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NL415_RS17730 (3510406) | 3510406..3510657 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NL415_RS17735 (3510651) | 3510651..3511001 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
NL415_RS17740 (3511080) | 3511080..3511610 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NL415_RS17745 (3511920) | 3511920..3512876 | + | 957 | WP_000265935.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NL415_RS17750 (3513009) | 3513009..3514511 | + | 1503 | WP_001024741.1 | sugar ABC transporter ATP-binding protein | - |
NL415_RS17755 (3514525) | 3514525..3515547 | + | 1023 | WP_001468884.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T269839 WP_000239581.1 NZ_CP117016:3510651-3511001 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|