Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2776916..2777528 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A167AMN3 |
Locus tag | NL415_RS14355 | Protein ID | WP_000833474.1 |
Coordinates | 2777343..2777528 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A1V3VHB3 |
Locus tag | NL415_RS14350 | Protein ID | WP_000499746.1 |
Coordinates | 2776916..2777326 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS14335 (2772428) | 2772428..2773243 | - | 816 | WP_000891838.1 | AraC family transcriptional regulator | - |
NL415_RS14340 (2773469) | 2773469..2774869 | + | 1401 | WP_000204815.1 | MFS transporter | - |
NL415_RS14345 (2774880) | 2774880..2776844 | + | 1965 | WP_001026871.1 | glycoside hydrolase family 127 protein | - |
NL415_RS14350 (2776916) | 2776916..2777326 | - | 411 | WP_000499746.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NL415_RS14355 (2777343) | 2777343..2777528 | - | 186 | WP_000833474.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NL415_RS14360 (2778001) | 2778001..2779080 | + | 1080 | WP_000061479.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
NL415_RS14365 (2779121) | 2779121..2780659 | - | 1539 | WP_001469350.1 | aldehyde dehydrogenase AldB | - |
NL415_RS14370 (2780860) | 2780860..2782011 | - | 1152 | WP_000741506.1 | L-threonine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6819.94 Da Isoelectric Point: 12.0345
>T269837 WP_000833474.1 NZ_CP117016:c2777528-2777343 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15290.22 Da Isoelectric Point: 4.5486
>AT269837 WP_000499746.1 NZ_CP117016:c2777326-2776916 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A167AMN3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3VHB3 |