Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1870889..1871543 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NL415_RS09905 | Protein ID | WP_000244781.1 |
Coordinates | 1870889..1871296 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL415_RS09910 | Protein ID | WP_000354046.1 |
Coordinates | 1871277..1871543 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS09885 (1866846) | 1866846..1868579 | - | 1734 | WP_000813176.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NL415_RS09890 (1868585) | 1868585..1869295 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL415_RS09895 (1869320) | 1869320..1870216 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NL415_RS09900 (1870328) | 1870328..1870849 | + | 522 | WP_001055872.1 | flavodoxin FldB | - |
NL415_RS09905 (1870889) | 1870889..1871296 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
NL415_RS09910 (1871277) | 1871277..1871543 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL415_RS09915 (1871786) | 1871786..1872766 | + | 981 | WP_000886075.1 | tRNA-modifying protein YgfZ | - |
NL415_RS09920 (1872843) | 1872843..1873502 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
NL415_RS09925 (1873666) | 1873666..1873977 | - | 312 | WP_001182958.1 | N(4)-acetylcytidine aminohydrolase | - |
NL415_RS09930 (1874022) | 1874022..1875455 | + | 1434 | WP_034173731.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269835 WP_000244781.1 NZ_CP117016:c1871296-1870889 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|