Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1751226..1751809 | Replicon | chromosome |
Accession | NZ_CP117016 | ||
Organism | Escherichia coli strain MLI121 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A377LAP4 |
Locus tag | NL415_RS09405 | Protein ID | WP_000254736.1 |
Coordinates | 1751226..1751561 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NL415_RS09410 | Protein ID | WP_000581937.1 |
Coordinates | 1751561..1751809 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL415_RS09390 (1747114) | 1747114..1748412 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
NL415_RS09395 (1748500) | 1748500..1750137 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NL415_RS09400 (1750364) | 1750364..1751155 | - | 792 | WP_001071667.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NL415_RS09405 (1751226) | 1751226..1751561 | - | 336 | WP_000254736.1 | endoribonuclease MazF | Toxin |
NL415_RS09410 (1751561) | 1751561..1751809 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NL415_RS09415 (1751887) | 1751887..1754121 | - | 2235 | WP_000226799.1 | GTP diphosphokinase | - |
NL415_RS09420 (1754169) | 1754169..1755470 | - | 1302 | WP_000046786.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12125.11 Da Isoelectric Point: 8.7181
>T269834 WP_000254736.1 NZ_CP117016:c1751561-1751226 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGKVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGKVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A377LAP4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |