Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 44669..45270 | Replicon | plasmid p95_MLI121 |
| Accession | NZ_CP117014 | ||
| Organism | Escherichia coli strain MLI121 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A6G4LZ59 |
| Locus tag | NL415_RS00340 | Protein ID | WP_001216040.1 |
| Coordinates | 44890..45270 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NL415_RS00335 | Protein ID | WP_001190712.1 |
| Coordinates | 44669..44890 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL415_RS00285 (NL415_000285) | 40066..40191 | + | 126 | Protein_56 | hypothetical protein | - |
| NL415_RS00290 (NL415_000290) | 40478..40741 | + | 264 | WP_089629837.1 | hypothetical protein | - |
| NL415_RS00295 (NL415_000295) | 40752..40877 | + | 126 | Protein_58 | hypothetical protein | - |
| NL415_RS00300 (NL415_000300) | 40899..41375 | + | 477 | Protein_59 | dTDP-6-deoxy-L-hexose 3-O-methyltransferase | - |
| NL415_RS00305 (NL415_000305) | 41364..42272 | + | 909 | WP_235636550.1 | hypothetical protein | - |
| NL415_RS00310 (NL415_000310) | 42256..42540 | + | 285 | WP_001142395.1 | hypothetical protein | - |
| NL415_RS00315 (NL415_000315) | 42540..42845 | + | 306 | WP_000988220.1 | hypothetical protein | - |
| NL415_RS00320 (NL415_000320) | 42842..43366 | + | 525 | WP_000159955.1 | toprim domain-containing protein | - |
| NL415_RS00325 (NL415_000325) | 43614..44003 | + | 390 | WP_000506732.1 | S24 family peptidase | - |
| NL415_RS00330 (NL415_000330) | 44138..44560 | + | 423 | WP_000098854.1 | hypothetical protein | - |
| NL415_RS00335 (NL415_000335) | 44669..44890 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL415_RS00340 (NL415_000340) | 44890..45270 | + | 381 | WP_001216040.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NL415_RS00345 (NL415_000345) | 45306..46400 | - | 1095 | WP_000201932.1 | hypothetical protein | - |
| NL415_RS00350 (NL415_000350) | 46390..47157 | - | 768 | WP_000446290.1 | hypothetical protein | - |
| NL415_RS00355 (NL415_000355) | 47164..47604 | - | 441 | WP_001061875.1 | DUF2829 domain-containing protein | - |
| NL415_RS00360 (NL415_000360) | 47619..48113 | - | 495 | WP_000640907.1 | dUTP diphosphatase | - |
| NL415_RS00365 (NL415_000365) | 48110..48586 | - | 477 | WP_000861172.1 | hypothetical protein | - |
| NL415_RS00370 (NL415_000370) | 48583..48927 | - | 345 | WP_001191775.1 | hypothetical protein | - |
| NL415_RS00375 (NL415_000375) | 49001..50029 | - | 1029 | WP_001292231.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..95886 | 95886 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13678.59 Da Isoelectric Point: 6.2282
>T269827 WP_001216040.1 NZ_CP117014:44890-45270 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDDPVLVELAVGAATGEIPVSSVAKKLRELYGSNI
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDDPVLVELAVGAATGEIPVSSVAKKLRELYGSNI
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G4LZ59 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |