Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 44669..45270 Replicon plasmid p95_MLI121
Accession NZ_CP117014
Organism Escherichia coli strain MLI121

Toxin (Protein)


Gene name doc Uniprot ID A0A6G4LZ59
Locus tag NL415_RS00340 Protein ID WP_001216040.1
Coordinates 44890..45270 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL415_RS00335 Protein ID WP_001190712.1
Coordinates 44669..44890 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL415_RS00285 (NL415_000285) 40066..40191 + 126 Protein_56 hypothetical protein -
NL415_RS00290 (NL415_000290) 40478..40741 + 264 WP_089629837.1 hypothetical protein -
NL415_RS00295 (NL415_000295) 40752..40877 + 126 Protein_58 hypothetical protein -
NL415_RS00300 (NL415_000300) 40899..41375 + 477 Protein_59 dTDP-6-deoxy-L-hexose 3-O-methyltransferase -
NL415_RS00305 (NL415_000305) 41364..42272 + 909 WP_235636550.1 hypothetical protein -
NL415_RS00310 (NL415_000310) 42256..42540 + 285 WP_001142395.1 hypothetical protein -
NL415_RS00315 (NL415_000315) 42540..42845 + 306 WP_000988220.1 hypothetical protein -
NL415_RS00320 (NL415_000320) 42842..43366 + 525 WP_000159955.1 toprim domain-containing protein -
NL415_RS00325 (NL415_000325) 43614..44003 + 390 WP_000506732.1 S24 family peptidase -
NL415_RS00330 (NL415_000330) 44138..44560 + 423 WP_000098854.1 hypothetical protein -
NL415_RS00335 (NL415_000335) 44669..44890 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL415_RS00340 (NL415_000340) 44890..45270 + 381 WP_001216040.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL415_RS00345 (NL415_000345) 45306..46400 - 1095 WP_000201932.1 hypothetical protein -
NL415_RS00350 (NL415_000350) 46390..47157 - 768 WP_000446290.1 hypothetical protein -
NL415_RS00355 (NL415_000355) 47164..47604 - 441 WP_001061875.1 DUF2829 domain-containing protein -
NL415_RS00360 (NL415_000360) 47619..48113 - 495 WP_000640907.1 dUTP diphosphatase -
NL415_RS00365 (NL415_000365) 48110..48586 - 477 WP_000861172.1 hypothetical protein -
NL415_RS00370 (NL415_000370) 48583..48927 - 345 WP_001191775.1 hypothetical protein -
NL415_RS00375 (NL415_000375) 49001..50029 - 1029 WP_001292231.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95886 95886


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13678.59 Da        Isoelectric Point: 6.2282

>T269827 WP_001216040.1 NZ_CP117014:44890-45270 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDDPVLVELAVGAATGEIPVSSVAKKLRELYGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269827 WP_001190712.1 NZ_CP117014:44669-44890 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6G4LZ59

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References