Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4696569..4697164 | Replicon | chromosome |
| Accession | NZ_CP117013 | ||
| Organism | Escherichia coli strain MLI114 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | NL414_RS23450 | Protein ID | WP_000239581.1 |
| Coordinates | 4696569..4696919 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | NL414_RS23455 | Protein ID | WP_001223213.1 |
| Coordinates | 4696913..4697164 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL414_RS23430 (4692023) | 4692023..4693045 | - | 1023 | WP_001468884.1 | ABC transporter permease | - |
| NL414_RS23435 (4693059) | 4693059..4694561 | - | 1503 | WP_001024741.1 | sugar ABC transporter ATP-binding protein | - |
| NL414_RS23440 (4694694) | 4694694..4695650 | - | 957 | WP_000265935.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NL414_RS23445 (4695960) | 4695960..4696490 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| NL414_RS23450 (4696569) | 4696569..4696919 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| NL414_RS23455 (4696913) | 4696913..4697164 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NL414_RS23460 (4697376) | 4697376..4697717 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| NL414_RS23465 (4697720) | 4697720..4701499 | - | 3780 | WP_000060909.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T269825 WP_000239581.1 NZ_CP117013:c4696919-4696569 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|