Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4685028..4685550 | Replicon | chromosome |
Accession | NZ_CP117013 | ||
Organism | Escherichia coli strain MLI114 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | NL414_RS23390 | Protein ID | WP_001105433.1 |
Coordinates | 4685028..4685318 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | NL414_RS23395 | Protein ID | WP_000212715.1 |
Coordinates | 4685308..4685550 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL414_RS23375 (4680218) | 4680218..4681873 | + | 1656 | WP_001392998.1 | alpha,alpha-phosphotrehalase | - |
NL414_RS23380 (4682267) | 4682267..4684405 | + | 2139 | WP_000187799.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL414_RS23385 (4684563) | 4684563..4685027 | + | 465 | WP_001106233.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL414_RS23390 (4685028) | 4685028..4685318 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL414_RS23395 (4685308) | 4685308..4685550 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL414_RS23400 (4685742) | 4685742..4686128 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
NL414_RS23405 (4686312) | 4686312..4687664 | - | 1353 | WP_001162171.1 | metalloprotease PmbA | - |
NL414_RS23410 (4687758) | 4687758..4688309 | + | 552 | WP_000166295.1 | ribosome biogenesis factor YjgA | - |
NL414_RS23415 (4688461) | 4688461..4689834 | - | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T269824 WP_001105433.1 NZ_CP117013:c4685318-4685028 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |