Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4591454..4592286 | Replicon | chromosome |
| Accession | NZ_CP117013 | ||
| Organism | Escherichia coli strain MLI114 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | NL414_RS22895 | Protein ID | WP_000854765.1 |
| Coordinates | 4591454..4591828 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL414_RS22900 | Protein ID | WP_001295723.1 |
| Coordinates | 4591918..4592286 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL414_RS22875 (4586971) | 4586971..4589862 | - | 2892 | WP_000580534.1 | SNF2-related protein | - |
| NL414_RS22880 (4590518) | 4590518..4590667 | - | 150 | Protein_4381 | hypothetical protein | - |
| NL414_RS22885 (4590773) | 4590773..4590949 | - | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
| NL414_RS22890 (4590966) | 4590966..4591457 | - | 492 | WP_000976842.1 | DUF5983 family protein | - |
| NL414_RS22895 (4591454) | 4591454..4591828 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| NL414_RS22900 (4591918) | 4591918..4592286 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL414_RS22905 (4592449) | 4592449..4592670 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL414_RS22910 (4592733) | 4592733..4593209 | - | 477 | WP_001186775.1 | RadC family protein | - |
| NL414_RS22915 (4593225) | 4593225..4593698 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NL414_RS22920 (4594040) | 4594040..4594858 | - | 819 | WP_001234652.1 | DUF932 domain-containing protein | - |
| NL414_RS22925 (4594976) | 4594976..4595171 | - | 196 | Protein_4390 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T269823 WP_000854765.1 NZ_CP117013:c4591828-4591454 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269823 WP_001295723.1 NZ_CP117013:c4592286-4591918 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|