Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3904260..3904878 | Replicon | chromosome |
Accession | NZ_CP117013 | ||
Organism | Escherichia coli strain MLI114 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NL414_RS19625 | Protein ID | WP_001291435.1 |
Coordinates | 3904660..3904878 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NL414_RS19620 | Protein ID | WP_000344800.1 |
Coordinates | 3904260..3904634 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL414_RS19610 (3899349) | 3899349..3900542 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL414_RS19615 (3900565) | 3900565..3903714 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
NL414_RS19620 (3904260) | 3904260..3904634 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NL414_RS19625 (3904660) | 3904660..3904878 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NL414_RS19630 (3905050) | 3905050..3905601 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NL414_RS19635 (3905717) | 3905717..3906187 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NL414_RS19640 (3906351) | 3906351..3907901 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NL414_RS19645 (3907943) | 3907943..3908296 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NL414_RS19655 (3908675) | 3908675..3908986 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NL414_RS19660 (3909017) | 3909017..3909589 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269820 WP_001291435.1 NZ_CP117013:3904660-3904878 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269820 WP_000344800.1 NZ_CP117013:3904260-3904634 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |