Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3191703..3192498 | Replicon | chromosome |
| Accession | NZ_CP117013 | ||
| Organism | Escherichia coli strain MLI114 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7UP43 |
| Locus tag | NL414_RS16265 | Protein ID | WP_000854914.1 |
| Coordinates | 3191703..3192077 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | NL414_RS16270 | Protein ID | WP_001280955.1 |
| Coordinates | 3192124..3192498 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL414_RS16225 (3186707) | 3186707..3187198 | - | 492 | WP_032159295.1 | DUF1097 domain-containing protein | - |
| NL414_RS16230 (3187300) | 3187300..3187854 | - | 555 | WP_001001926.1 | molecular chaperone YcdY | - |
| NL414_RS16235 (3187878) | 3187878..3188615 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| NL414_RS16240 (3188670) | 3188670..3189608 | - | 939 | WP_000351297.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| NL414_RS16250 (3190079) | 3190079..3190921 | - | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
| NL414_RS16255 (3191006) | 3191006..3191203 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| NL414_RS16260 (3191215) | 3191215..3191706 | - | 492 | WP_000976857.1 | DUF5983 family protein | - |
| NL414_RS16265 (3191703) | 3191703..3192077 | - | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
| NL414_RS16270 (3192124) | 3192124..3192498 | - | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL414_RS16275 (3192661) | 3192661..3192882 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| NL414_RS16280 (3192945) | 3192945..3193421 | - | 477 | WP_001186726.1 | RadC family protein | - |
| NL414_RS16285 (3193437) | 3193437..3193922 | - | 486 | WP_000214307.1 | antirestriction protein | - |
| NL414_RS16290 (3194014) | 3194014..3194835 | - | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| NL414_RS16295 (3194936) | 3194936..3195144 | - | 209 | Protein_3096 | DUF905 family protein | - |
| NL414_RS16300 (3195245) | 3195245..3195700 | - | 456 | WP_000581506.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG / aafC / aggD / iroC / iroD / iroE / iroE / iroN | 3183088..3245863 | 62775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T269818 WP_000854914.1 NZ_CP117013:c3192077-3191703 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT269818 WP_001280955.1 NZ_CP117013:c3192498-3192124 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LXR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9P0D0 |