Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3191703..3192498 Replicon chromosome
Accession NZ_CP117013
Organism Escherichia coli strain MLI114

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag NL414_RS16265 Protein ID WP_000854914.1
Coordinates 3191703..3192077 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7UP42
Locus tag NL414_RS16270 Protein ID WP_001280955.1
Coordinates 3192124..3192498 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL414_RS16225 (3186707) 3186707..3187198 - 492 WP_032159295.1 DUF1097 domain-containing protein -
NL414_RS16230 (3187300) 3187300..3187854 - 555 WP_001001926.1 molecular chaperone YcdY -
NL414_RS16235 (3187878) 3187878..3188615 - 738 WP_000283664.1 zinc-binding phosphatase -
NL414_RS16240 (3188670) 3188670..3189608 - 939 WP_000351297.1 glyoxylate/hydroxypyruvate reductase GhrA -
NL414_RS16250 (3190079) 3190079..3190921 - 843 WP_001280481.1 DUF4942 domain-containing protein -
NL414_RS16255 (3191006) 3191006..3191203 - 198 WP_000839282.1 DUF957 domain-containing protein -
NL414_RS16260 (3191215) 3191215..3191706 - 492 WP_000976857.1 DUF5983 family protein -
NL414_RS16265 (3191703) 3191703..3192077 - 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
NL414_RS16270 (3192124) 3192124..3192498 - 375 WP_001280955.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL414_RS16275 (3192661) 3192661..3192882 - 222 WP_001220314.1 DUF987 domain-containing protein -
NL414_RS16280 (3192945) 3192945..3193421 - 477 WP_001186726.1 RadC family protein -
NL414_RS16285 (3193437) 3193437..3193922 - 486 WP_000214307.1 antirestriction protein -
NL414_RS16290 (3194014) 3194014..3194835 - 822 WP_001761104.1 DUF932 domain-containing protein -
NL414_RS16295 (3194936) 3194936..3195144 - 209 Protein_3096 DUF905 family protein -
NL414_RS16300 (3195245) 3195245..3195700 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG / aafC / aggD / iroC / iroD / iroE / iroE / iroN 3183088..3245863 62775


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T269818 WP_000854914.1 NZ_CP117013:c3192077-3191703 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13767.59 Da        Isoelectric Point: 6.6248

>AT269818 WP_001280955.1 NZ_CP117013:c3192498-3192124 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9P0D0

References