Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1070961..1071615 | Replicon | chromosome |
Accession | NZ_CP117013 | ||
Organism | Escherichia coli strain MLI114 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NL414_RS05645 | Protein ID | WP_000244781.1 |
Coordinates | 1071208..1071615 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL414_RS05640 | Protein ID | WP_000354046.1 |
Coordinates | 1070961..1071227 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL414_RS05620 (1067049) | 1067049..1068482 | - | 1434 | WP_034173731.1 | 6-phospho-beta-glucosidase BglA | - |
NL414_RS05625 (1068527) | 1068527..1068838 | + | 312 | WP_001182958.1 | N(4)-acetylcytidine aminohydrolase | - |
NL414_RS05630 (1069002) | 1069002..1069661 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
NL414_RS05635 (1069738) | 1069738..1070718 | - | 981 | WP_000886075.1 | tRNA-modifying protein YgfZ | - |
NL414_RS05640 (1070961) | 1070961..1071227 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL414_RS05645 (1071208) | 1071208..1071615 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NL414_RS05650 (1071655) | 1071655..1072176 | - | 522 | WP_001055872.1 | flavodoxin FldB | - |
NL414_RS05655 (1072288) | 1072288..1073184 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NL414_RS05660 (1073209) | 1073209..1073919 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL414_RS05665 (1073925) | 1073925..1075658 | + | 1734 | WP_000813176.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269810 WP_000244781.1 NZ_CP117013:1071208-1071615 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|