Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 159942..160554 | Replicon | chromosome |
| Accession | NZ_CP117013 | ||
| Organism | Escherichia coli strain MLI114 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A167AMN3 |
| Locus tag | NL414_RS01180 | Protein ID | WP_000833474.1 |
| Coordinates | 159942..160127 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1V3VHB3 |
| Locus tag | NL414_RS01185 | Protein ID | WP_000499746.1 |
| Coordinates | 160144..160554 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL414_RS01165 (155459) | 155459..156610 | + | 1152 | WP_000741506.1 | L-threonine dehydrogenase | - |
| NL414_RS01170 (156811) | 156811..158349 | + | 1539 | WP_001469350.1 | aldehyde dehydrogenase AldB | - |
| NL414_RS01175 (158390) | 158390..159469 | - | 1080 | WP_000061479.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NL414_RS01180 (159942) | 159942..160127 | + | 186 | WP_000833474.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NL414_RS01185 (160144) | 160144..160554 | + | 411 | WP_000499746.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NL414_RS01190 (160626) | 160626..162590 | - | 1965 | WP_001026871.1 | glycoside hydrolase family 127 protein | - |
| NL414_RS01195 (162601) | 162601..164001 | - | 1401 | WP_000204815.1 | MFS transporter | - |
| NL414_RS01200 (164227) | 164227..165042 | + | 816 | WP_000891838.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6819.94 Da Isoelectric Point: 12.0345
>T269808 WP_000833474.1 NZ_CP117013:159942-160127 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15290.22 Da Isoelectric Point: 4.5486
>AT269808 WP_000499746.1 NZ_CP117013:160144-160554 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A167AMN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V3VHB3 |