Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2156618..2157256 | Replicon | chromosome |
Accession | NZ_CP117010 | ||
Organism | Escherichia coli strain MLI110 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NL413_RS11100 | Protein ID | WP_000813794.1 |
Coordinates | 2156618..2156794 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL413_RS11105 | Protein ID | WP_001270286.1 |
Coordinates | 2156840..2157256 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL413_RS11080 (2152237) | 2152237..2153412 | - | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
NL413_RS11085 (2153504) | 2153504..2154040 | + | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
NL413_RS11090 (2154113) | 2154113..2156074 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL413_RS11095 (2156166) | 2156166..2156396 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NL413_RS11100 (2156618) | 2156618..2156794 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL413_RS11105 (2156840) | 2156840..2157256 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL413_RS11110 (2157335) | 2157335..2158741 | + | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
NL413_RS11115 (2158986) | 2158986..2160131 | + | 1146 | WP_257812150.1 | ABC transporter substrate-binding protein | - |
NL413_RS11120 (2160149) | 2160149..2161162 | + | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
NL413_RS11125 (2161163) | 2161163..2162104 | + | 942 | WP_001251313.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2150932..2152197 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T269794 WP_000813794.1 NZ_CP117010:2156618-2156794 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269794 WP_001270286.1 NZ_CP117010:2156840-2157256 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|