Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 49918..50519 Replicon plasmid p122_MLI110
Accession NZ_CP117009
Organism Escherichia coli strain MLI110

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NL413_RS00275 Protein ID WP_001216034.1
Coordinates 50139..50519 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL413_RS00270 Protein ID WP_001190712.1
Coordinates 49918..50139 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL413_RS00240 (NL413_000240) 46066..46680 - 615 WP_032214276.1 acid-sensing system DNA-binding response regulator EvgA -
NL413_RS00245 (NL413_000245) 47054..47751 + 698 WP_226453243.1 IS1 family transposase -
NL413_RS00250 (NL413_000250) 47894..48043 + 150 Protein_49 IS3 family transposase -
NL413_RS00255 (NL413_000255) 48070..48174 + 105 Protein_50 IS3 family transposase -
NL413_RS00260 (NL413_000260) 48478..48771 + 294 WP_226438991.1 biofilm development regulator YmgB/AriR family protein -
NL413_RS00270 (NL413_000270) 49918..50139 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL413_RS00275 (NL413_000275) 50139..50519 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL413_RS00280 (NL413_000280) 50524..50703 + 180 WP_001513661.1 hypothetical protein -
NL413_RS00285 (NL413_000285) 50731..51009 + 279 Protein_56 pdcB -
NL413_RS00290 (NL413_000290) 51014..51427 + 414 Protein_57 integrase core domain-containing protein -
NL413_RS00295 (NL413_000295) 51377..51712 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NL413_RS00300 (NL413_000300) 51922..52902 - 981 WP_000019402.1 IS5-like element IS5 family transposase -
NL413_RS00305 (NL413_000305) 53146..54549 + 1404 WP_001373486.1 S-methylmethionine permease -
NL413_RS00310 (NL413_000310) 54536..55468 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-15 / qnrS1 - 1..122030 122030
- inside IScluster/Tn - - 47248..57502 10254


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T269787 WP_001216034.1 NZ_CP117009:50139-50519 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269787 WP_001190712.1 NZ_CP117009:49918-50139 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References