Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4604346..4604941 | Replicon | chromosome |
| Accession | NZ_CP117008 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
| Locus tag | NL412_RS23315 | Protein ID | WP_019842229.1 |
| Coordinates | 4604346..4604696 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | NL412_RS23320 | Protein ID | WP_001223213.1 |
| Coordinates | 4604690..4604941 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS23295 (4599676) | 4599676..4600698 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
| NL412_RS23300 (4600712) | 4600712..4602214 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
| NL412_RS23305 (4602346) | 4602346..4603302 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NL412_RS23310 (4603612) | 4603612..4604142 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| NL412_RS23315 (4604346) | 4604346..4604696 | - | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
| NL412_RS23320 (4604690) | 4604690..4604941 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NL412_RS23325 (4605153) | 4605153..4605494 | - | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
| NL412_RS23330 (4605497) | 4605497..4609276 | - | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T269784 WP_019842229.1 NZ_CP117008:c4604696-4604346 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NWK6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | L4JJX7 |