Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4592684..4593206 | Replicon | chromosome |
| Accession | NZ_CP117008 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | NL412_RS23255 | Protein ID | WP_001105433.1 |
| Coordinates | 4592684..4592974 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | NL412_RS23260 | Protein ID | WP_000212715.1 |
| Coordinates | 4592964..4593206 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS23240 (4587852) | 4587852..4589507 | + | 1656 | WP_001550509.1 | alpha,alpha-phosphotrehalase | - |
| NL412_RS23245 (4589901) | 4589901..4592039 | + | 2139 | WP_255073496.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL412_RS23250 (4592219) | 4592219..4592683 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL412_RS23255 (4592684) | 4592684..4592974 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL412_RS23260 (4592964) | 4592964..4593206 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL412_RS23265 (4593398) | 4593398..4593784 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
| NL412_RS23270 (4593967) | 4593967..4595319 | - | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
| NL412_RS23275 (4595413) | 4595413..4595964 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
| NL412_RS23280 (4596114) | 4596114..4597487 | - | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T269783 WP_001105433.1 NZ_CP117008:c4592974-4592684 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |