Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3203805..3204589 | Replicon | chromosome |
Accession | NZ_CP117008 | ||
Organism | Escherichia coli strain MLI109 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NL412_RS16785 | Protein ID | WP_000613626.1 |
Coordinates | 3204095..3204589 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NL412_RS16780 | Protein ID | WP_001110447.1 |
Coordinates | 3203805..3204098 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL412_RS16770 (3198955) | 3198955..3199914 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
NL412_RS16775 (3200487) | 3200487..3203672 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
NL412_RS16780 (3203805) | 3203805..3204098 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NL412_RS16785 (3204095) | 3204095..3204589 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NL412_RS16790 (3204684) | 3204684..3205637 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NL412_RS16795 (3205649) | 3205649..3207292 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
NL412_RS16800 (3207358) | 3207358..3208299 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NL412_RS16805 (3208299) | 3208299..3209396 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T269778 WP_000613626.1 NZ_CP117008:3204095-3204589 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|