Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 62636..63291 Replicon plasmid p140_MLI109
Accession NZ_CP117007
Organism Escherichia coli strain MLI109

Toxin (Protein)


Gene name vagD Uniprot ID A0A2B7QJJ1
Locus tag NL412_RS00335 Protein ID WP_001441071.1
Coordinates 62636..63037 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A0E0YAG4
Locus tag NL412_RS00340 Protein ID WP_001261288.1
Coordinates 63061..63291 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL412_RS00315 (57744) 57744..58169 + 426 WP_032278491.1 transposase -
NL412_RS00320 (58166) 58166..58516 + 351 WP_044807173.1 IS66 family insertion sequence element accessory protein TnpB -
NL412_RS00325 (58547) 58547..60104 + 1558 Protein_64 IS66-like element ISEc23 family transposase -
NL412_RS00330 (60328) 60328..62466 + 2139 WP_032269946.1 ATPase AAA -
NL412_RS00335 (62636) 62636..63037 - 402 WP_001441071.1 type II toxin-antitoxin system VapC family toxin Toxin
NL412_RS00340 (63061) 63061..63291 - 231 WP_001261288.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NL412_RS00345 (63885) 63885..64103 + 219 WP_167792262.1 type II toxin-antitoxin system antitoxin CcdA -
NL412_RS00350 (64105) 64105..64410 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NL412_RS00355 (64411) 64411..65220 + 810 Protein_70 site-specific integrase -
NL412_RS00360 (65358) 65358..65633 - 276 WP_000239529.1 hypothetical protein -
NL412_RS00365 (65627) 65627..66271 - 645 WP_000633911.1 AAA family ATPase -
NL412_RS00370 (66500) 66500..67471 + 972 WP_001103689.1 plasmid segregation protein ParM -
NL412_RS00375 (67476) 67476..67868 + 393 WP_000340832.1 plasmid partitioning/stability family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - agg3D / agg3C / agg3B / aap/aspU / pic 1..140278 140278


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14517.89 Da        Isoelectric Point: 7.2456

>T269758 WP_001441071.1 NZ_CP117007:c63037-62636 [Escherichia coli]
MLDTNICSFIMREQPAAVIKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIALVDAFCARLDAILPWDRAAVDAT
TEIKMALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 402 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8684.76 Da        Isoelectric Point: 4.3654

>AT269758 WP_001261288.1 NZ_CP117007:c63291-63061 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWSSFAALEKADADFMAEREDIVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2B7QJJ1

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0YAG4

References