Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 62636..63291 | Replicon | plasmid p140_MLI109 |
| Accession | NZ_CP117007 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A2B7QJJ1 |
| Locus tag | NL412_RS00335 | Protein ID | WP_001441071.1 |
| Coordinates | 62636..63037 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A0E0YAG4 |
| Locus tag | NL412_RS00340 | Protein ID | WP_001261288.1 |
| Coordinates | 63061..63291 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS00315 (57744) | 57744..58169 | + | 426 | WP_032278491.1 | transposase | - |
| NL412_RS00320 (58166) | 58166..58516 | + | 351 | WP_044807173.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL412_RS00325 (58547) | 58547..60104 | + | 1558 | Protein_64 | IS66-like element ISEc23 family transposase | - |
| NL412_RS00330 (60328) | 60328..62466 | + | 2139 | WP_032269946.1 | ATPase AAA | - |
| NL412_RS00335 (62636) | 62636..63037 | - | 402 | WP_001441071.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NL412_RS00340 (63061) | 63061..63291 | - | 231 | WP_001261288.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NL412_RS00345 (63885) | 63885..64103 | + | 219 | WP_167792262.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NL412_RS00350 (64105) | 64105..64410 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| NL412_RS00355 (64411) | 64411..65220 | + | 810 | Protein_70 | site-specific integrase | - |
| NL412_RS00360 (65358) | 65358..65633 | - | 276 | WP_000239529.1 | hypothetical protein | - |
| NL412_RS00365 (65627) | 65627..66271 | - | 645 | WP_000633911.1 | AAA family ATPase | - |
| NL412_RS00370 (66500) | 66500..67471 | + | 972 | WP_001103689.1 | plasmid segregation protein ParM | - |
| NL412_RS00375 (67476) | 67476..67868 | + | 393 | WP_000340832.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | agg3D / agg3C / agg3B / aap/aspU / pic | 1..140278 | 140278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14517.89 Da Isoelectric Point: 7.2456
>T269758 WP_001441071.1 NZ_CP117007:c63037-62636 [Escherichia coli]
MLDTNICSFIMREQPAAVIKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIALVDAFCARLDAILPWDRAAVDAT
TEIKMALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
MLDTNICSFIMREQPAAVIKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIALVDAFCARLDAILPWDRAAVDAT
TEIKMALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2B7QJJ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0YAG4 |