Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 49704..50263 Replicon plasmid p140_MLI109
Accession NZ_CP117007
Organism Escherichia coli strain MLI109

Toxin (Protein)


Gene name relE Uniprot ID A0A7B2ZE18
Locus tag NL412_RS00265 Protein ID WP_032250674.1
Coordinates 49988..50263 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag NL412_RS00260 Protein ID WP_001387467.1
Coordinates 49704..49988 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL412_RS00235 (45089) 45089..45655 - 567 Protein_46 zinc-binding dehydrogenase -
NL412_RS00240 (46008) 46008..46898 + 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
NL412_RS00245 (46923) 46923..47303 + 381 WP_097514827.1 Rid family detoxifying hydrolase -
NL412_RS00250 (47336) 47336..48301 + 966 WP_023063778.1 2-keto-3-deoxygluconate transporter -
NL412_RS00255 (48347) 48347..49099 - 753 WP_001403368.1 IclR family transcriptional regulator -
NL412_RS00260 (49704) 49704..49988 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
NL412_RS00265 (49988) 49988..50263 + 276 WP_032250674.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL412_RS00270 (50369) 50369..50572 + 204 Protein_53 hypothetical protein -
NL412_RS00275 (50697) 50697..50825 - 129 Protein_54 IS481 family transposase -
NL412_RS00280 (50858) 50858..52027 - 1170 WP_032250676.1 hypothetical protein -
NL412_RS00285 (52559) 52559..52827 + 269 Protein_56 type II toxin-antitoxin system ParD family antitoxin -
NL412_RS00290 (52814) 52814..53104 + 291 Protein_57 type II toxin-antitoxin system RelE/ParE family toxin -
NL412_RS00295 (53171) 53171..53353 + 183 WP_050488504.1 hypothetical protein -
NL412_RS00300 (53474) 53474..54214 + 741 WP_001066941.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - agg3D / agg3C / agg3B / aap/aspU / pic 1..140278 140278


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10750.48 Da        Isoelectric Point: 9.9324

>T269757 WP_032250674.1 NZ_CP117007:49988-50263 [Escherichia coli]
MELKWTSKALSDLSRLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGELLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT269757 WP_001387467.1 NZ_CP117007:49704-49988 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7B2ZE18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References