Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3610297..3610915 | Replicon | chromosome |
| Accession | NZ_CP117006 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NL411_RS19110 | Protein ID | WP_001291435.1 |
| Coordinates | 3610697..3610915 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NL411_RS19105 | Protein ID | WP_000344800.1 |
| Coordinates | 3610297..3610671 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS19095 (3605386) | 3605386..3606579 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL411_RS19100 (3606602) | 3606602..3609751 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NL411_RS19105 (3610297) | 3610297..3610671 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NL411_RS19110 (3610697) | 3610697..3610915 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NL411_RS19115 (3611087) | 3611087..3611638 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NL411_RS19120 (3611754) | 3611754..3612224 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NL411_RS19125 (3612388) | 3612388..3613938 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NL411_RS19130 (3613980) | 3613980..3614333 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
| NL411_RS19140 (3614712) | 3614712..3615023 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NL411_RS19145 (3615054) | 3615054..3615626 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269751 WP_001291435.1 NZ_CP117006:3610697-3610915 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269751 WP_000344800.1 NZ_CP117006:3610297-3610671 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |