Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3151288..3151993 | Replicon | chromosome |
Accession | NZ_CP117006 | ||
Organism | Escherichia coli strain MLI108K3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NL411_RS16965 | Protein ID | WP_000539521.1 |
Coordinates | 3151288..3151674 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NL411_RS16970 | Protein ID | WP_001280945.1 |
Coordinates | 3151664..3151993 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL411_RS16945 (3147292) | 3147292..3147918 | + | 627 | WP_001595548.1 | glutathione S-transferase GstB | - |
NL411_RS16950 (3147915) | 3147915..3149030 | - | 1116 | WP_001595547.1 | aldose sugar dehydrogenase YliI | - |
NL411_RS16955 (3149141) | 3149141..3149524 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NL411_RS16960 (3149737) | 3149737..3151062 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NL411_RS16965 (3151288) | 3151288..3151674 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL411_RS16970 (3151664) | 3151664..3151993 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NL411_RS16975 (3152063) | 3152063..3153391 | - | 1329 | WP_049068068.1 | GGDEF domain-containing protein | - |
NL411_RS16980 (3153399) | 3153399..3155747 | - | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
NL411_RS16985 (3155925) | 3155925..3156836 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T269750 WP_000539521.1 NZ_CP117006:3151288-3151674 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|