Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2513905..2514543 | Replicon | chromosome |
| Accession | NZ_CP117006 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NL411_RS13805 | Protein ID | WP_000813795.1 |
| Coordinates | 2514367..2514543 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NL411_RS13800 | Protein ID | WP_076797675.1 |
| Coordinates | 2513905..2514321 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS13780 (2509057) | 2509057..2509998 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NL411_RS13785 (2509999) | 2509999..2511012 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| NL411_RS13790 (2511030) | 2511030..2512175 | - | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| NL411_RS13795 (2512420) | 2512420..2513826 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| NL411_RS13800 (2513905) | 2513905..2514321 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NL411_RS13805 (2514367) | 2514367..2514543 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NL411_RS13810 (2514765) | 2514765..2514995 | + | 231 | WP_023910283.1 | YncJ family protein | - |
| NL411_RS13815 (2515087) | 2515087..2517048 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NL411_RS13820 (2517121) | 2517121..2517657 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| NL411_RS13825 (2517749) | 2517749..2518921 | + | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T269748 WP_000813795.1 NZ_CP117006:c2514543-2514367 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT269748 WP_076797675.1 NZ_CP117006:c2514321-2513905 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|