Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1881145..1881977 Replicon chromosome
Accession NZ_CP117006
Organism Escherichia coli strain MLI108K3

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1L4HFA4
Locus tag NL411_RS10600 Protein ID WP_032163901.1
Coordinates 1881145..1881519 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL411_RS10605 Protein ID WP_001295723.1
Coordinates 1881609..1881977 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL411_RS10560 (1876541) 1876541..1877707 + 1167 WP_042031746.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NL411_RS10565 (1877826) 1877826..1878299 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
NL411_RS10570 (1878497) 1878497..1879555 + 1059 WP_001200891.1 FUSC family protein -
NL411_RS10575 (1879727) 1879727..1880056 + 330 WP_000450409.1 DUF496 family protein -
NL411_RS10580 (1880157) 1880157..1880291 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NL411_RS10585 (1880411) 1880411..1880539 + 129 Protein_1753 transposase domain-containing protein -
NL411_RS10590 (1880828) 1880828..1880908 - 81 Protein_1754 hypothetical protein -
NL411_RS10595 (1880954) 1880954..1881148 - 195 WP_000988600.1 DUF5983 family protein -
NL411_RS10600 (1881145) 1881145..1881519 - 375 WP_032163901.1 TA system toxin CbtA family protein Toxin
NL411_RS10605 (1881609) 1881609..1881977 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL411_RS10610 (1882140) 1882140..1882361 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL411_RS10615 (1882424) 1882424..1882900 - 477 WP_001186726.1 RadC family protein -
NL411_RS10620 (1882916) 1882916..1883401 - 486 WP_000849582.1 antirestriction protein -
NL411_RS10625 (1883456) 1883456..1884274 - 819 WP_040061766.1 DUF932 domain-containing protein -
NL411_RS10630 (1884374) 1884374..1884607 - 234 WP_001119729.1 DUF905 family protein -
NL411_RS10635 (1884686) 1884686..1885141 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13919.89 Da        Isoelectric Point: 7.7760

>T269742 WP_032163901.1 NZ_CP117006:c1881519-1881145 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269742 WP_001295723.1 NZ_CP117006:c1881977-1881609 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L4HFA4

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References