Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 929512..930172 | Replicon | chromosome |
| Accession | NZ_CP117006 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NL411_RS06105 | Protein ID | WP_029701967.1 |
| Coordinates | 929759..930172 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NL411_RS06100 | Protein ID | WP_000354046.1 |
| Coordinates | 929512..929778 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS06075 (924800) | 924800..925543 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| NL411_RS06080 (925600) | 925600..927033 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| NL411_RS06085 (927078) | 927078..927389 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NL411_RS06090 (927553) | 927553..928212 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NL411_RS06095 (928289) | 928289..929269 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
| NL411_RS06100 (929512) | 929512..929778 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NL411_RS06105 (929759) | 929759..930172 | + | 414 | WP_029701967.1 | protein YgfX | Toxin |
| NL411_RS06110 (930206) | 930206..930727 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NL411_RS06115 (930839) | 930839..931735 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NL411_RS06120 (931759) | 931759..932469 | + | 711 | WP_029701969.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NL411_RS06125 (932475) | 932475..934208 | + | 1734 | WP_029701971.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16305.25 Da Isoelectric Point: 11.7064
>T269738 WP_029701967.1 NZ_CP117006:929759-930172 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLLHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
VVLWQSDLRVSWRAQWLSLLLHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |