Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 836864..837696 | Replicon | chromosome |
| Accession | NZ_CP117006 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3P5UBZ5 |
| Locus tag | NL411_RS05600 | Protein ID | WP_001094454.1 |
| Coordinates | 836864..837238 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3G8RJV8 |
| Locus tag | NL411_RS05605 | Protein ID | WP_001320394.1 |
| Coordinates | 837328..837696 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS05570 (831977) | 831977..833125 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| NL411_RS05575 (833197) | 833197..834180 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NL411_RS05580 (834991) | 834991..835161 | - | 171 | Protein_777 | IS110 family transposase | - |
| NL411_RS05585 (835504) | 835504..836073 | - | 570 | WP_001290250.1 | DUF4942 domain-containing protein | - |
| NL411_RS05590 (836170) | 836170..836367 | - | 198 | WP_000839276.1 | DUF957 domain-containing protein | - |
| NL411_RS05595 (836379) | 836379..836867 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| NL411_RS05600 (836864) | 836864..837238 | - | 375 | WP_001094454.1 | TA system toxin CbtA family protein | Toxin |
| NL411_RS05605 (837328) | 837328..837696 | - | 369 | WP_001320394.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL411_RS05610 (837746) | 837746..838389 | - | 644 | Protein_783 | antitoxin of toxin-antitoxin stability system | - |
| NL411_RS05615 (838408) | 838408..838629 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| NL411_RS05620 (838692) | 838692..839168 | - | 477 | WP_001347688.1 | RadC family protein | - |
| NL411_RS05625 (839184) | 839184..839669 | - | 486 | WP_029701480.1 | antirestriction protein | - |
| NL411_RS05630 (839724) | 839724..840542 | - | 819 | WP_001234642.1 | DUF932 domain-containing protein | - |
| NL411_RS05635 (840642) | 840642..840875 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| NL411_RS05640 (840954) | 840954..841409 | - | 456 | WP_000581493.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14059.10 Da Isoelectric Point: 9.2447
>T269737 WP_001094454.1 NZ_CP117006:c837238-836864 [Escherichia coli]
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13623.22 Da Isoelectric Point: 6.4783
>AT269737 WP_001320394.1 NZ_CP117006:c837696-837328 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P5UBZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G8RJV8 |