Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 39535..40082 Replicon plasmid p89_MLI108-3
Accession NZ_CP117004
Organism Escherichia coli strain MLI108K3

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NL411_RS01335 Protein ID WP_250145987.1
Coordinates 39535..39813 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A829FT18
Locus tag NL411_RS01340 Protein ID WP_000079938.1
Coordinates 39813..40082 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL411_RS01310 (36631) 36631..37029 - 399 WP_228990980.1 DUF2946 domain-containing protein -
NL411_RS01315 (37411) 37411..38415 + 1005 WP_021546935.1 IS110-like element IS4321 family transposase -
NL411_RS01320 (38890) 38890..39150 + 261 Protein_43 transposase -
NL411_RS01325 (39160) 39160..39333 - 174 Protein_44 hypothetical protein -
NL411_RS01330 (39345) 39345..39482 - 138 WP_152931508.1 hypothetical protein -
NL411_RS01335 (39535) 39535..39813 - 279 WP_250145987.1 type II toxin-antitoxin system toxin YacB Toxin
NL411_RS01340 (39813) 39813..40082 - 270 WP_000079938.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NL411_RS01345 (40155) 40155..40295 - 141 WP_160784086.1 hypothetical protein -
NL411_RS01350 (40996) 40996..41853 - 858 WP_025269864.1 incFII family plasmid replication initiator RepA -
NL411_RS01355 (41846) 41846..41920 - 75 WP_061357229.1 RepA leader peptide Tap -
NL411_RS01360 (42152) 42152..42409 - 258 WP_001541895.1 replication regulatory protein RepA -
NL411_RS01365 (42693) 42693..42842 - 150 WP_001312851.1 Hok/Gef family protein -
- (42886) 42886..42947 + 62 NuclAT_0 - -
- (42886) 42886..42947 + 62 NuclAT_0 - -
- (42886) 42886..42947 + 62 NuclAT_0 - -
- (42886) 42886..42947 + 62 NuclAT_0 - -
NL411_RS01370 (43289) 43289..43501 - 213 WP_001541896.1 ANR family transcriptional regulator -
NL411_RS01375 (43636) 43636..44196 - 561 WP_097734074.1 fertility inhibition protein FinO -
NL411_RS01380 (44251) 44251..44997 - 747 WP_001541899.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..89004 89004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10836.52 Da        Isoelectric Point: 8.0410

>T269730 WP_250145987.1 NZ_CP117004:c39813-39535 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMVAIELDERIGYSASSLAGQPYKGRNCRVEGARELVIHPHFVLVYEVDSQWGKVY
ILRVLHTTQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10251.64 Da        Isoelectric Point: 10.1734

>AT269730 WP_000079938.1 NZ_CP117004:c40082-39813 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLKRGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829FT18

References