Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 26389..26936 Replicon plasmid p95_MLI108-3
Accession NZ_CP117003
Organism Escherichia coli strain MLI108K3

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NL411_RS00725 Protein ID WP_001384452.1
Coordinates 26658..26936 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1M1SX19
Locus tag NL411_RS00720 Protein ID WP_021546940.1
Coordinates 26389..26658 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL411_RS00690 (NL411_000690) 22094..22678 - 585 WP_000645940.1 DUF1788 domain-containing protein -
NL411_RS00695 (NL411_000695) 22675..23274 - 600 WP_001021938.1 DUF1819 family protein -
NL411_RS00700 (NL411_000700) 23284..24210 - 927 WP_000617209.1 WYL domain-containing protein -
NL411_RS00705 (NL411_000705) 24279..24596 - 318 WP_032156934.1 hypothetical protein -
NL411_RS00710 (NL411_000710) 24820..24999 + 180 WP_012600012.1 hypothetical protein -
NL411_RS00715 (NL411_000715) 25031..25642 - 612 Protein_20 IS3 family transposase -
NL411_RS00720 (NL411_000720) 26389..26658 + 270 WP_021546940.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NL411_RS00725 (NL411_000725) 26658..26936 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NL411_RS00730 (NL411_000730) 26982..27194 + 213 Protein_23 3'-5' exonuclease -
NL411_RS00735 (NL411_000735) 27289..27525 + 237 WP_223417154.1 transposase -
NL411_RS00740 (NL411_000740) 27778..29529 - 1752 Protein_25 Tn3-like element TnAs1 family transposase -
NL411_RS00745 (NL411_000745) 29533..29925 + 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
NL411_RS00750 (NL411_000750) 30063..30947 + 885 WP_000058717.1 EamA family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / qnrS1 - 1..95344 95344
- inside IScluster/Tn tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / qnrS1 - 25031..57775 32744


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T269729 WP_001384452.1 NZ_CP117003:26658-26936 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10321.69 Da        Isoelectric Point: 8.8725

>AT269729 WP_021546940.1 NZ_CP117003:26389-26658 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMRRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1SX19

References