Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 33574..34372 | Replicon | plasmid p108_MLI108-3 |
| Accession | NZ_CP117002 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | E2QDF3 |
| Locus tag | NL411_RS00205 | Protein ID | WP_000072677.1 |
| Coordinates | 33851..34372 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | NL411_RS00200 | Protein ID | WP_042063163.1 |
| Coordinates | 33574..33843 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS00175 (NL411_000175) | 28998..30338 | - | 1341 | WP_094308010.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NL411_RS00180 (NL411_000180) | 30382..31122 | - | 741 | WP_094308011.1 | hypothetical protein | - |
| NL411_RS00185 (NL411_000185) | 31405..32172 | + | 768 | WP_000342417.1 | hypothetical protein | - |
| NL411_RS00190 (NL411_000190) | 32228..32581 | - | 354 | WP_160378290.1 | hypothetical protein | - |
| NL411_RS00195 (NL411_000195) | 32587..33255 | - | 669 | WP_042063113.1 | division plane positioning ATPase MipZ | - |
| NL411_RS00200 (NL411_000200) | 33574..33843 | + | 270 | WP_042063163.1 | DUF1778 domain-containing protein | Antitoxin |
| NL411_RS00205 (NL411_000205) | 33851..34372 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
| NL411_RS00210 (NL411_000210) | 34541..34792 | - | 252 | WP_001404395.1 | hypothetical protein | - |
| NL411_RS00215 (NL411_000215) | 34794..35486 | - | 693 | WP_042063115.1 | membrane protein | - |
| NL411_RS00220 (NL411_000220) | 35500..35823 | - | 324 | WP_000064175.1 | hypothetical protein | - |
| NL411_RS00225 (NL411_000225) | 36005..36289 | - | 285 | WP_021520115.1 | hypothetical protein | - |
| NL411_RS00230 (NL411_000230) | 36300..37004 | - | 705 | WP_000235971.1 | tail fiber domain-containing protein | - |
| NL411_RS00235 (NL411_000235) | 37014..37295 | - | 282 | WP_042063118.1 | hypothetical protein | - |
| NL411_RS00240 (NL411_000240) | 37295..39205 | - | 1911 | Protein_44 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fdeC | 1..108353 | 108353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T269728 WP_000072677.1 NZ_CP117002:33851-34372 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|