Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4266958..4267576 | Replicon | chromosome |
Accession | NZ_CP117001 | ||
Organism | Escherichia coli strain MLI108K2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NL410_RS22660 | Protein ID | WP_001291435.1 |
Coordinates | 4266958..4267176 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NL410_RS22665 | Protein ID | WP_000344800.1 |
Coordinates | 4267202..4267576 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL410_RS22625 (4262247) | 4262247..4262819 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
NL410_RS22630 (4262850) | 4262850..4263161 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NL410_RS22640 (4263540) | 4263540..4263893 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NL410_RS22645 (4263935) | 4263935..4265485 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NL410_RS22650 (4265649) | 4265649..4266119 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NL410_RS22655 (4266235) | 4266235..4266786 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NL410_RS22660 (4266958) | 4266958..4267176 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NL410_RS22665 (4267202) | 4267202..4267576 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NL410_RS22670 (4268122) | 4268122..4271271 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NL410_RS22675 (4271294) | 4271294..4272487 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269727 WP_001291435.1 NZ_CP117001:c4267176-4266958 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269727 WP_000344800.1 NZ_CP117001:c4267576-4267202 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |